Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DDC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Rabbit Polyclonal Anti-ABP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709) |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit polyclonal ASPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-110 amino acids from the N-terminal region of human ASPA. |
Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381) |
Rabbit polyclonal HNMT Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human HNMT. |
Rabbit Polyclonal Anti-HAL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-HAL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI |
Anti-ALDH3A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1 |
Anti-ACY3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-HDC Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human histidine decarboxylase |
Anti-ALDH3B1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1 |
Anti-ALDH9A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1 |
Rabbit Polyclonal Anti-ASPA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASPA |
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CNDP1 |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALDH3A2 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Histidine metabolism