Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Rabbit polyclonal PLCG1 (Ab-771) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A). |
Rabbit polyclonal anti-PIK3C2G antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human P3C2G. |
USD 345.00
In Stock
Rabbit polyclonal anti-MINPP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MINPP1. |
Rabbit Polyclonal Phospho-PLCG1 (Tyr771) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PLCG1 (Tyr783) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 around the phosphorylation site of Tyrosine 783 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PTEN (Ser370) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN around the phosphorylation site of Serine 370 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PLCG2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG2 |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PLCG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PLCG1 |
Rabbit Polyclonal PTEN Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PTEN |
Rabbit Polyclonal Phospho-PLCG2 (Tyr753) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PLCG2 around the phosphorylation site of Tyrosine 753. |
| Modifications | Phospho-specific |
Anti-ALDH6A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 6 family, member A1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- Inositol phosphate metabolism
Availabilities
- In Stock