Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids. |
Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal DR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5. |
Rabbit Polyclonal Anti-FASL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit Polyclonal Anti-CD253 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Rabbit Polyclonal Trail Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail. |
Rabbit polyclonal anti-AIFM1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIFM1. |
Rabbit polyclonal Trk A (Phospho-Tyr701) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 701 (I-L-YP-R-K). |
| Modifications | Phospho-specific |
TNFRSF10C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFRSF10C |
Rabbit anti-TNFRSF10B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFRSF10B |
Rabbit Polyclonal Anti-PDCD8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the C terminal of human PDCD8. Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST |
Rabbit Polyclonal Anti-Bax Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit Polyclonal Anti-TR10A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TR10A Antibody: A synthesized peptide derived from human TR10A |
Rabbit Polyclonal Anti-BCL-2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL-2 Antibody: A synthesized peptide derived from human BCL-2 |
Rabbit Polyclonal Anti-FAS ligand Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-1RAcP. The immunogen is located within the last 50 amino acids of IL-1RAcP. |
Rabbit polyclonal anti-TNFRSF10D antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFRSF10D. |
Rabbit polyclonal anti-TR10A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TR10A. |
Rabbit polyclonal anti-ENDOGL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ENDOGL1. |
Anti-BCL2L1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 1-210 amino acids of Human Bcl-2-like protein 1 |
Rabbit Polyclonal BCL-2 (Ser70) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 70 |
| Modifications | Phospho-specific |
Rabbit Polyclonal BCL-2 (Ser87) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-2 around the phosphorylation site of Serine 87 |
| Modifications | Phospho-specific |
Rabbit Polyclonal BCL-XL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL |
Rabbit Polyclonal BCL-XL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL |
Rabbit Polyclonal BCL-XL (Ser62) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL around the phosphorylation site of Serine 62 |
| Modifications | Phospho-specific |
Rabbit Polyclonal BCL-XL (Thr47) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BCL-XL around the phosphorylation site of Threonine 47 |
| Modifications | Phospho-specific |
Rabbit polyclonal BCL2 (Phospho-Ser70) antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BCL2 around the phosphorylation site of serine 70 (R-T-SP-P-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ENDOD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENDOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENDOD1. Synthetic peptide located within the following region: DLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSS |
Rabbit Polyclonal AIF Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | AIF antibody was raised against a peptide corresponding to amino acids near the amino terminus of mature human AIF. The immunogen is located within amino acids 90 - 140 of AIF. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Apoptosis