Antibodies

View as table Download

Rabbit Polyclonal Anti-SDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

Rabbit Polyclonal Anti-NDUFV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG

Rabbit polyclonal ATP6V1B1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1.

ATP5A (ATP5A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human ATP5A1 protein (aa 201-250).

Rabbit Polyclonal antibody to UQCRC1 (ubiquinol-cytochrome c reductase core protein I)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of UQCRC1 (Uniprot ID#P31930)

Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912)

Rabbit polyclonal anti-ATP5A1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATP5A1.

Rabbit Polyclonal Anti-ATP6V1C1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1C1 antibody: synthetic peptide directed towards the N terminal of human ATP6V1C1. Synthetic peptide located within the following region: ldafvegvvkkvaqymadvledskdkvqenllangvdlvtyitrfqwdma

Rabbit anti-ATP5B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP5B

Rabbit Polyclonal Anti-LHPP Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Lhpp antibody is: synthetic peptide directed towards the C-terminal region of Lhpp. Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

Rabbit Polyclonal Anti-LHPP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHPP antibody: synthetic peptide directed towards the middle region of human LHPP. Synthetic peptide located within the following region: ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufv2 antibody: synthetic peptide directed towards the C terminal of human Ndufv2. Synthetic peptide located within the following region: DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ndufv2 antibody is: synthetic peptide directed towards the N-terminal region of Ndufv2. Synthetic peptide located within the following region: GAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPV

Rabbit Polyclonal Anti-LCMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

SDHA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of Human SDHA

Rabbit Polyclonal antibody to NDUFS4 (NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 175 of NDUFS4 (Uniprot ID#O43181)

Rabbit polyclonal anti-NDUFV2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFV2.

Rabbit polyclonal anti-CYC1 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYC1.

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404)

Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821)

Rabbit anti-SDHA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SDHA

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the middle region of human ATP6V1B2. Synthetic peptide located within the following region: NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Rabbit polyclonal SDHA Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SDHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 577-605 amino acids from the C-terminal region of human SDHA.

Rabbit Polyclonal Anti-ATP4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP4B antibody: synthetic peptide directed towards the middle region of human ATP4B. Synthetic peptide located within the following region: QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK

Rabbit Polyclonal Anti-Atp4b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Atp4b antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKL

Rabbit Polyclonal Anti-ATP6V1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A. Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Rabbit Polyclonal Anti-ATP6V1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B1 antibody: synthetic peptide directed towards the middle region of human ATP6V1B1. Synthetic peptide located within the following region: LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL

Rabbit Polyclonal Anti-ATP6V1B2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1B2 antibody: synthetic peptide directed towards the N terminal of human ATP6V1B2. Synthetic peptide located within the following region: VSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSG

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV

Rabbit Polyclonal Anti-CYC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP

Rabbit Polyclonal Anti-NDUFS4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFS4

Rabbit Polyclonal Anti-NDUFV1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFV1

Rabbit Polyclonal Anti-NDUFV2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFV2

Rabbit Polyclonal Anti-SDHA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SDHA

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCRC2

Rabbit Polyclonal Anti-SDHB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SDHB