Antibodies

View as table Download

Rabbit Polyclonal Anti-DTX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DTX4 antibody was raised against a 19 amino acid peptide near the center of human DTX4.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ATG4B.

Rabbit polyclonal anti-ATG4B antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4B.

Rabbit Polyclonal Anti-ATG4B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B. Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS

Rabbit Polyclonal Anti-ATG4B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ATG4B Antibody: A synthesized peptide derived from human ATG4B

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Rabbit Polyclonal ATG4B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 350-400 of human APG4B was used as the immunogen.

Rabbit polyclonal anti-ATG4B antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATG4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-290 amino acids from the Central region of human ATG4B.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG4B Antibody: synthetic peptide directed towards the C terminal of human ATG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Anti-APG4B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 5-20 amino acids of Human Autophagy-related protein 4 homolog B

ATG4B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-393 of human ATG4B (NP_037457.3).
Modifications Unmodified

ATG4B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-393 of human ATG4B (NP_037457.3).
Modifications Unmodified