Antibodies

View as table Download

Rabbit anti-CXCR3 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CXCR3

Rabbit Polyclonal CX3CR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1.

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Polyclonal CCR1 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was raised against a synthetic peptide of human CCR1 protein.

Rabbit Polyclonal CCR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3.

Rabbit Polyclonal Anti-CXCR4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4

Rabbit polyclonal anti-CCR2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding to amino acid 353 of rat CCR2

Rabbit Polyclonal CX3CR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a peptide corresponding to amino acids 2 to 21 of human CX3CR1. The sequence differs from those of mouse and rat CX3CR1 by four amino acids (NP_001328).

Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CXCR4 (extracellular)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EGISIYTSDNYTEE,corresponding to amino acid residues 2-15 of human CXCR4. Extracellular, N-terminus.

Rabbit polyclonal anti-ADCY5/6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6.

Anti-CCR3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-25 amino acids of human chemokine (C-C motif) receptor 3

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073]

Rabbit Polyclonal CXCR4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4.

Rabbit polyclonal anti-ADCY5/ADCY6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306).

Rabbit polyclonal anti-ADCY8 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY8.

Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336
Modifications Phospho-specific

Rabbit Polyclonal CXCR3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CXCR3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human CXCR3

Rabbit Polyclonal CCR5 Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CCR5

Rabbit Polyclonal Anti-CCR7 (extracellular)

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide (C)DEVTDDYIGDNTTVD, corresponding to amino acid residues 26-40 of human CCR7. Extracellular, N-terminus.

Rabbit Polyclonal CX3CL1/Fractalkine Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human CX3CL protein (within residues 20-150). [Swiss-Prot P78423]

Rabbit polyclonal anti-ADCY1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY1.

Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human Fractalkine

Rabbit Polyclonal CXCR4 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Sheep
Conjugation Unconjugated
Immunogen Rabbit anti-CXCR4 polyclonal antibody was raised against a peptide corresponding to amino acids 328-338 of human CXCR4.

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

Rabbit Polyclonal CCR3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCR3 antibody was raised against a 14 amino acid peptide from near the amino terminus of human CCR3.

Rabbit Polyclonal CX3CL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CX3CL1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human CX3CL1 .

Rabbit polyclonal CCR5 (Ser336) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 336 (R-A-SP-S-V).
Modifications Phospho-specific

Rabbit polyclonal anti-ADCY4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY4.

Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347
Modifications Phospho-specific

Rabbit Polyclonal CXCR3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a synthetic peptide corresponding to amino acids 290-303 of human CXCR3.

Rabbit Polyclonal Anti-CXCR5 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR5 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CXCR5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Dog, Bovine, Hamster, Panda, Rabbit, Pig (94%).

Anti-CX3CR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-21 amino acids of Human chemokine (C-X3-C motif) receptor 1

Anti-CX3CR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-21 amino acids of Human chemokine (C-X3-C motif) receptor 1

Anti-CXCR3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 351-364 amino acids of Human chemokine (C-X-C motif) receptor 3

Anti-CXCR2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-39 amino acids of Human Chemokine (C-X-C motif) receptor 2

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human C-C chemokine receptor type 8

Anti-CCL15 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 94-103 amino acids of Human chemokine (C-C motif) ligand 15

Anti-ADCY1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain)

Anti-ADCY1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain)

Anti-CX3CL1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 368-381 amino acids of Human chemokine (C-X3-C motif) ligand 1

Anti-CCL24 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 27-119 amino acids of human chemokine (C-C motif) ligand 24chemokine (C-C motif) ligand 24

Anti-CCR7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 35-48 amino acids of Human C-C chemokine receptor type 7

Anti-CXCR5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-34 amino acids of Human chemokine (C-X-C motif) receptor 5

Anti-ADCY7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 520-535 amino acids of human adenylate cyclase 7

Anti-CXCR3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-89 amino acids of human chemokine (C-X-C motif) receptor 3

Anti-CCR3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-25 amino acids of human chemokine (C-C motif) receptor 3

Anti-ADCY4 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4

Anti-ADCY4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4