Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIB3 antibody: synthetic peptide directed towards the N terminal of human TRIB3. Synthetic peptide located within the following region: YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV |
Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV |
TRB3 / TRIB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Human |
| Immunogen | TRB3 / TRIB3 antibody was raised against synthetic 16 amino acid peptide from near C-terminus of human TRIB3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Panda, Dog, Bovine, Rabbit, Pig (94%); Elephant (88%); Mouse, Horse, Opossum (81%). |
TRB3 / TRIB3 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | TRB3 / TRIB3 antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human TRIB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset (94%); Mouse, Rat (88%); Elephant, Horse (81%). |
TRIB3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TRIB3 (NP_066981.2). |
| Modifications | Unmodified |
TRIB3 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human TRIB3 |
