Antibodies

Jump to Filters
View as table Download
xCT (SLC7A11) Rabbit Polyclonal Antibody
TA301518

USD 479.00

2 Weeks

Rabbit Polyclonal Antibody against XCT

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50).
xCT (SLC7A11) Rabbit Polyclonal Antibody
TA336629

USD 457.00

5 Days

Rabbit Polyclonal xCT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the mouse xCT protein (between residues 1-50). [UniProt# Q9WTR6]
xCT (SLC7A11) Rabbit Polyclonal Antibody
TA317674

USD 425.00

5 Days

XCT / SLC7A11 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen SLC7A11 / XCT antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human SLC7A11. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (95%); Sheep, Panda, Rabbit (84%).
xCT (SLC7A11) Rabbit Polyclonal Antibody
TA333870

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC7A11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
xCT (SLC7A11) Rabbit Polyclonal Antibody
TA351958

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SLC7A11 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC7A11