Antibodies

View as table Download

Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1.

Rabbit monoclonal antibody against Phospho-c-Myc (pT58/S62)(E203) (phospho-specific)

Applications FC, IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Modifications Phospho-specific

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit anti-PIAS2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PIAS2

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

Rabbit Polyclonal c-Myc Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2

Rabbit Polyclonal Anti-MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MYC Antibody: A synthesized peptide derived from human MYC

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Cyclin D1 (CCND1) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen CCND1 antibody was raised against kLH conjugated synthetic peptide corresponding to amino acid residues surrounding S90 of human Cyclin D1.

c-Myc (MYC) rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Conjugation Biotin
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

c-Myc (MYC) rabbit polyclonal antibody, HRP

Applications ELISA, IHC, WB
Conjugation HRP
Immunogen Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc.

Rabbit polyclonal anti-PIAS2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS2.

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286.

Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90
Modifications Phospho-specific

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc

Rabbit Polyclonal Myc (Thr58) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Threonine 58
Modifications Phospho-specific

c-Myc (MYC) rabbit polyclonal antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against MYC (T58)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

Rabbit Polyclonal Antibody against MYC (S62)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-69 amino acids from human MYC.

Rabbit Polyclonal Antibody against MYC (S373)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 351-380 amino acids from human MYC.

Rabbit Polyclonal Cyclin D1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Cyclin D1

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC

Rabbit Polyclonal Myc (Ser62) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Serine 62
Modifications Phospho-specific

Rabbit Polyclonal Anti-Pias2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE

Rabbit anti Myc-Tag Polyclonal Antibody

Applications WB
Conjugation Unconjugated
Immunogen A synthetic peptide of EQKLISEEDL conjugated to a carrier protein.

c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S).

c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S).

Cyclin D1 (CCND1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CCND1

Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1

Rabbit polyclonal Cyclin D1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-Cyclin D1 was produced by repeated immunizations of full length fusion protein corresponding to the human gene sequence.

Rabbit polyclonal CCND1 Antibody (C-term T288)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CCND1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 267-294 amino acids from the C-terminal region of human CCND1.

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIAS2 Antibody: synthetic peptide directed towards the N terminal of human PIAS2. Synthetic peptide located within the following region: RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: LTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 antibody: synthetic peptide directed towards the C terminal of human PIAS2. Synthetic peptide located within the following region: FLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDI

Rabbit anti Cyclin D1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat.

Rabbit anti c-Myc Polyclonal Antibody

Conjugation Unconjugated

Rabbit anti Myc(pT358) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti Myc(pT58) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIAS2