Rabbit Polyclonal Antibody against XCT
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal Antibody against XCT
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal xCT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus of the mouse xCT protein (between residues 1-50). [UniProt# Q9WTR6] |
XCT / SLC7A11 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | SLC7A11 / XCT antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human SLC7A11. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (95%); Sheep, Panda, Rabbit (84%). |
Rabbit Polyclonal Anti-SLC7A11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK |
Rabbit Polyclonal Anti-SLC7A11 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC7A11 |