ANXA1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANXA1 |
ANXA1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANXA1 |
Rabbit polyclonal antibody to Annexin A1 (annexin A1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083) |
Rabbit Polyclonal Annexin A1 Antibody
Applications | ELISA, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal ANXA1 (Ab-21) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ANXA1 around the phosphorylation site of tyrosine 21 (Q-E-YP-V-Q). |
Rabbit Polyclonal Anti-ANXA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD |
Annexin A1 (ANXA1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Canine, Human, Monkey |
Immunogen | Synthetic peptides (KLH-coupled) corresponding to residues within the aminoterminal residues of human annexin A1 |
Rabbit anti Annexin I Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ANXA1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANXA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Annexin A1 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |