Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Feline, Fish, Human, Mouse, Porcine, Rat |
| Immunogen | Human placental type IV Collagen. |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal ZIPK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ZIP kinase antibody was raised against a peptide corresponding to amino acids near the center of human ZIP kinase. The immunogen is located within amino acids 270 - 320 of ZIPK. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Phospho-NOS3-S1177 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1177 of human NOS3 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
