Germany
Japan
United Kingdom
China
Antibodies
Download
USD 345.00
In Stock
Rabbit Polyclonal Anti-RRAS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RRAS |
Rabbit Polyclonal Anti-TMSB4X Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TMSB4X |
USD 345.00
In Stock
CRK Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ITGB5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ITGB5 |
FGD3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF19 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DIAPH1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
WASF1 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP |
FGF20 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ITGA5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BDKRB1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
VAV1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human VAV1 |
BRAF V600E Rabbit monoclonal antibody,clone OTIR1F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BRAF V600E Rabbit monoclonal antibody,clone OTIR1F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF23 Rabbit monoclonal antibody,clone OTIR5D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF23 Rabbit monoclonal antibody,clone OTIR5D11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Antibody Hosts
- Rabbit
Pathways
- Regulation of actin cytoskeleton
Filter by
Target Symbol
- EGFR (79)
- MAP2K1 (26)
- RAF1 (26)
- PTK2 (25)
- PAK1 (24)
- PXN (23)
- EZR (22)
- PDGFRB (22)
- CFL1 (21)
- BRAF (20)
- FGFR1 (19)
- ACTB (18)
- EGF (15)
- PDGFB (15)
- ROCK2 (15)
- ITGB3 (14)
- MAPK3 (14)
- PIK3R1 (14)
- FGF4 (13)
- MAPK1 (13)
- LIMK1 (12)
- F2R (11)
- FN1 (11)
- LIMK2 (11)
- NCF1 (11)
- PDGFA (11)
- SHC1 (11)
- VCL (11)
- ITGA6 (10)
- VAV1 (10)
- BCAR1 (9)
- FGF2 (9)
- ITGA4 (9)
- ITGB1 (9)
- PDGFRA (9)
- ACTN2 (8)
- APC (8)
- CRK (8)
- FGF1 (8)
- FGFR2 (8)
- ITGAV (8)
- MAP2K2 (8)
- NRAS (8)
- PAK2 (8)
- ACTG1 (7)
- CHRM1 (7)
- FGFR3 (7)
- MSN (7)
- PAK5 (7)
- PPP1CB (7)
- RHOA (7)
- ACTN1 (6)
- ACTN3 (6)
- BDKRB1 (6)
- CRKL (6)
- CSK (6)
- FGF7 (6)
- ITGAX (6)
- ITGB4 (6)
- ITGB5 (6)
- PAK4 (6)
- PFN1 (6)
- ROCK1 (6)
- SLC9A1 (6)
- ACTN4 (5)
- CHRM2 (5)
- CHRM5 (5)
- F2 (5)
- FGF18 (5)
- GSN (5)
- ITGA2 (5)
- ITGA5 (5)
- ITGAM (5)
- ITGB2 (5)
- PAK3 (5)
- PDGFC (5)
- PIK3CD (5)
- PPP1CA (5)
- RAC1 (5)
- ARAF (4)
- ARPC1A (4)
- ARPC3 (4)
- BDKRB2 (4)
- CD14 (4)
- CDC42 (4)
- DOCK1 (4)
- FGF8 (4)
- GNA13 (4)
- HRAS (4)
- INS (4)
- MYL2 (4)
- MYL9 (4)
- MYLK3 (4)
- PIK3CA (4)
- PIK3CB (4)
- PIK3CG (4)
- PIK3R3 (4)
- PPP1CC (4)
- PPP1R12A (4)
- RDX (4)
Reactivities
- Human (860)
- Mouse (624)
- Rat (536)
- Bovine (36)
- Chicken (29)
- Monkey (13)
- Pig (11)
- Dog (10)
- Rhesus Monkey (10)
- Xenopus (9)
- Canis (8)
- Rabbit (8)
- Drosophila (6)
- Horse (6)
- Hamster (5)
- X. tropicalis (4)
- Bat (3)
- Gorilla (3)
- Zebrafish (3)
- Chimpanzee (2)
- Guinea Pig (2)
- Orang-Utan (2)
- Porcine (2)
- Sheep (2)
- All Species (1)
- Avian (1)
- C. elegans (1)
- Canine (1)
- Gibbon (1)
Applications
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (1006)
- Protein Kinase (397)
- Transmembrane (331)
- ES Cell Differentiation/IPS (289)
- Secreted Protein (189)
- Adult stem cells (128)
- Cancer stem cells (79)
- Stem cell relevant signaling - JAK/STAT signaling pathway (79)
- Stem cell - Pluripotency (61)
- Embryonic stem cells (49)
- GPCR (39)
- Induced pluripotent stem cells (33)
- Transcription Factors (21)
- Phosphatase (18)
- Stem cell relevant signaling - Wnt Signaling pathway (13)
- Protease (5)