Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 166 of HN1 (Uniprot ID#Q9UK76 isoform2) |
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 506 and 723 of LETM1 (Uniprot ID#O95202) |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal Anti-Claudin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 5 Antibody: A synthesized peptide derived from human Claudin 5 |
Rabbit Polyclonal Anti-Claudin 11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit Polyclonal antibody to CD98 (solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 89 and 433 of CD98 (Uniprot ID#P08195) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit Polyclonal anti-HSPA5 Antibody
| Applications | IF, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
| Conjugation | Unconjugated |
| Immunogen | Rat GRP78 (Bip) sythetic peptide (amino acids 645-654, C-terminus) conjugated to KLH. Identical to mouse and hamster GRP78 sequenes over residues EEDTSEKDEL. |
Rabbit Polyclonal Anti-TRAK1 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Rat, Dog, Pig, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF |
Rabbit Polyclonal antibody to LIMCH1 (LIM and calponin homology domains 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 734 and 1007 of LIMCH1 (Uniprot ID#Q9UPQ0) |
Rabbit polyclonal antibody to Calsequestrin-2 (calsequestrin 2 (cardiac muscle))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 124 and 388 of Calsequestrin 2 (Uniprot ID#O14958) |
Rabbit polyclonal antibody to DNAJB6 (DnaJ (Hsp40) homolog, subfamily B, member 6)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 116 of DNAJB6 (Uniprot ID#O75190) |
Rabbit polyclonal antibody to Peripherin (peripherin)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 215 of Peripherin (Uniprot ID#P41219) |
Rabbit Polyclonal Anti-Erk1/2 Antibody
| Applications | IF, WB |
| Reactivities | Chicken, Drosophila, Human, Mouse, Rat, Sheep, Xenopus, Cow |
| Conjugation | Unconjugated |
| Immunogen | A 35 residue synthetic peptide, corresponding to Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH. |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Guinea Pig, Human, Rat, Dog, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
Rabbit polyclonal antibody to Interleukin-17 receptor C (interleukin 17 receptor C)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 62 and 471 of Human Interleukin-17 receptor C |
Rabbit polyclonal antibody to MPI (mannose phosphate isomerase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 154 of MPI (Uniprot ID#P34949) |
Rabbit polyclonal antibody to zinc finger protein 574 (zinc finger protein 574)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 162 and 358 of ZNF574 (Uniprot ID#Q6ZN55) |
Rabbit Polyclonal antibody to Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 243 and 532 of Dyrk3 (Uniprot ID#O43781) |
Rabbit polyclonal Hsp110 Antibody
| Applications | WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat, Sheep, Yeast, Cow |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the sequence of hamster Hsp110; sequence identical to human and mouse |
Rabbit polyclonal Alpha B Crystallin Antibody
| Reactivities | Chicken, Human, Mouse, Rat, Cow |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to human alpha B crystallin conjugated to KLH. |
Rabbit anti Caspase 5 Polyclonal Antibody
| Reactivities | Hamster, Human, Mouse, Rabbit, Rat, Cow |
| Conjugation | Unconjugated |
Rabbit anti PLC gamma 1 Polyclonal Antibody
| Reactivities | Human, Rat, Cw |
| Conjugation | Unconjugated |
Recombinant Anti-Syntaxin (Clone SP6)
| Applications | IHC, WB |
| Reactivities | Guinea Pig, Hamster, Human, Rabbit, Rat, Dog, Pig, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-SNAP-25 (Clone SP12)
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Feline, Guinea Pig, Hamster, Human, Mouse, Rat, Pig, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-Rhodopsin (Clone Rho 1D4)
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish, Cow |
| Conjugation | Unconjugated |
Recombinant Anti-C5aR (Clone S5/1)
| Applications | Bl, ELISA, FC, IP, WB |
| Reactivities | Ferret, Human, Rabbit, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Reactivities
- Cow
Antibody Hosts
- Rabbit
Filter by
Category
Target Symbol
- HSPA5 (2)
- ACTC1 (1)
- ATG5 (1)
- C5AR1 (1)
- CASP5 (1)
- CASQ2 (1)
- CLDN11 (1)
- CLDN5 (1)
- CRYAB (1)
- DNAJB6 (1)
- DYRK3 (1)
- EEF2KMT (1)
- GK5 (1)
- GSTA4 (1)
- HSPA1A (1)
- HSPH1 (1)
- IL17RC (1)
- JPT1 (1)
- KRT10 (1)
- KRT13 (1)
- LETM1 (1)
- LIMCH1 (1)
- LOX (1)
- MAPK3 (1)
- MPI (1)
- MPP1 (1)
- NOTCH1 (1)
- NSUN6 (1)
- PDSS2 (1)
- PLCG1 (1)
- PNPT1 (1)
- PRPH (1)
- PUF60 (1)
- RANBP1 (1)
- RGS13 (1)
- RHO (1)
- RPA3 (1)
- SAT1 (1)
- SGSH (1)
- SLC25A33 (1)
- SLC3A2 (1)
- SNAP25 (1)
- SYNTAXIN (1)
- TRAK1 (1)
- TUBG1 (1)
- UQCRFS1 (1)
- VEGFA (1)
- ZNF346 (1)
- ZNF574 (1)
Isotypes
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
Pathways
- Metabolic pathways (5)
- Prion diseases (4)
- Antigen processing and presentation (3)
- Leukocyte transendothelial migration (3)
- Cardiac muscle contraction (2)
- Cell adhesion molecules (CAMs) (2)
- Pathways in cancer (2)
- Spliceosome (2)
- Tight junction (2)
- VEGF signaling pathway (2)
- Alzheimer's disease (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Arginine and proline metabolism (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- DNA replication (1)
- Dilated cardiomyopathy (1)
- Dorso-ventral axis formation (1)
- Drug metabolism - cytochrome P450 (1)
- Endocytosis (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Focal adhesion (1)
- Fructose and mannose metabolism (1)
- Glioma (1)
- Glutathione metabolism (1)
- Glycosaminoglycan degradation (1)
- Homologous recombination (1)
- Huntington's disease (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Lysosome (1)
- MAPK signaling pathway (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Mismatch repair (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- Nucleotide excision repair (1)
- Oxidative phosphorylation (1)
- Pancreatic cancer (1)
- Parkinson's disease (1)
- Phosphatidylinositol signaling system (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- T cell receptor signaling pathway (1)
- Terpenoid backbone biosynthesis (1)
- Vibrio cholerae infection (1)
- mTOR signaling pathway (1)