Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
USD 380.00
In Stock
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- IHC
Conjugates
- Unconjugated
Families
- Druggable Genome
Availabilities
- In Stock
Filter by
Target Symbol
- MAP2K1 (69)
- NME1 (58)
- MKI67 (54)
- TP53 (48)
- KLK8 (47)
- OTC (46)
- ERBB2 (45)
- NBN (45)
- PECAM1 (43)
- TG (43)
- CTAG1B (41)
- LIPG (41)
- PGR (40)
- CDKN2A (38)
- MAP2K3 (38)
- ABCB1 (34)
- ADIPOQ (33)
- CD4 (32)
- CD99 (32)
- CHGA (32)
- TOP2A (32)
- ERCC1 (31)
- PCNA (31)
- NKX3-1 (30)
- PTPRC (30)
- VSNL1 (30)
- JUN (29)
- CTNNB1 (28)
- PIK3C2A (28)
- PDCD1 (27)
- MS4A1 (26)
- SENP2 (26)
- NCAM1 (25)
- TYMP (25)
- ABAT (24)
- CD68 (24)
- MDM4 (24)
- PIK3CG (23)
- PROCR (23)
- AMACR (22)
- KIT (22)
- MCM2 (22)
- VBP1 (22)
- ESR1 (21)
- F13A1 (21)
- SERPINB3 (21)
- UBE2G2 (21)
- CD163 (20)
- ERG (20)
- GLI1 (20)
- MDM2 (20)
- MUC1 (20)
- NAPSA (20)
- RET (20)
- TYMS (20)
- AKT1 (19)
- APP (19)
- GCH1 (19)
- HSPD1 (19)
- MGMT (19)
- MTOR (19)
- NR3C1 (19)
- CD44 (18)
- CDH1 (18)
- IDO1 (18)
- MMP13 (18)
- NPR3 (18)
- RAB21 (18)
- BCL2 (17)
- CD40 (17)
- CR2 (17)
- CYP1A2 (17)
- DEF6 (17)
- FOS (17)
- LTA4H (17)
- RHOJ (17)
- TNFRSF8 (17)
- AFP (16)
- BSG (16)
- BTK (16)
- CD1C (16)
- CFI (16)
- CTSL (16)
- SIVA1 (16)
- SLA2 (16)
- UPRT (16)
- ACE2 (15)
- ALDH1L1 (15)
- BCL10 (15)
- CD2 (15)
- DECR1 (15)
- EGFR (15)
- FOLH1 (15)
- GBA (15)
- LOX (15)
- MME (15)
- PIK3R5 (15)
- PTPRE (15)
- RRM1 (15)
- TLK2 (15)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (1145)
- Metabolic pathways (1095)
- MAPK signaling pathway (639)
- Focal adhesion (602)
- Prostate cancer (585)
- Neurotrophin signaling pathway (504)
- Colorectal cancer (491)
- T cell receptor signaling pathway (489)
- ErbB signaling pathway (475)
- Toll-like receptor signaling pathway (459)
- Pancreatic cancer (447)
- Chronic myeloid leukemia (434)
- Melanoma (434)
- Endometrial cancer (433)
- Regulation of actin cytoskeleton (424)
- Glioma (422)
- Non-small cell lung cancer (410)
- Bladder cancer (406)
- Insulin signaling pathway (388)
- B cell receptor signaling pathway (387)
- Cell adhesion molecules (CAMs) (385)
- Progesterone-mediated oocyte maturation (375)
- Chemokine signaling pathway (363)
- Cytokine-cytokine receptor interaction (355)
- Acute myeloid leukemia (348)
- Apoptosis (348)
- Cell cycle (343)
- Renal cell carcinoma (341)
- Fc epsilon RI signaling pathway (340)
- Hematopoietic cell lineage (336)
- GnRH signaling pathway (302)
- Natural killer cell mediated cytotoxicity (299)
- Fc gamma R-mediated phagocytosis (294)
- Leukocyte transendothelial migration (293)
- Wnt signaling pathway (289)
- Jak-STAT signaling pathway (286)
- Small cell lung cancer (281)
- VEGF signaling pathway (264)
- p53 signaling pathway (261)
- Oocyte meiosis (258)
- Melanogenesis (256)
- Thyroid cancer (256)
- Gap junction (237)
- Adherens junction (229)
- Endocytosis (224)
- Amyotrophic lateral sclerosis (ALS) (218)
- Alzheimer's disease (207)
- Adipocytokine signaling pathway (204)
- Type II diabetes mellitus (204)
- Calcium signaling pathway (203)
- Vascular smooth muscle contraction (192)
- Purine metabolism (189)
- Long-term potentiation (187)
- Pyrimidine metabolism (185)
- Neuroactive ligand-receptor interaction (179)
- Long-term depression (177)
- mTOR signaling pathway (177)
- Axon guidance (159)
- Huntington's disease (159)
- Primary immunodeficiency (158)
- Prion diseases (154)
- Basal cell carcinoma (151)
- Complement and coagulation cascades (150)
- Epithelial cell signaling in Helicobacter pylori infection (148)
- Lysosome (145)
- Tight junction (145)
- Ubiquitin mediated proteolysis (143)
- Pathogenic Escherichia coli infection (129)
- Phosphatidylinositol signaling system (128)
- TGF-beta signaling pathway (128)
- Glycolysis / Gluconeogenesis (121)
- Dorso-ventral axis formation (114)
- NOD-like receptor signaling pathway (111)
- Nucleotide excision repair (111)
- ECM-receptor interaction (108)
- Glycerolipid metabolism (107)
- Dilated cardiomyopathy (105)
- Antigen processing and presentation (104)
- Autoimmune thyroid disease (104)
- RIG-I-like receptor signaling pathway (102)
- Arginine and proline metabolism (99)
- Parkinson's disease (99)
- PPAR signaling pathway (97)
- Inositol phosphate metabolism (96)
- Drug metabolism - cytochrome P450 (95)
- Metabolism of xenobiotics by cytochrome P450 (95)
- Hypertrophic cardiomyopathy (HCM) (91)
- Mismatch repair (90)
- Type I diabetes mellitus (90)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (87)
- Base excision repair (84)
- DNA replication (84)
- Viral myocarditis (82)
- Arachidonic acid metabolism (80)
- Hedgehog signaling pathway (79)
- Valine (79)
- Retinol metabolism (77)
- leucine and isoleucine degradation (77)
- Alanine (73)
- aspartate and glutamate metabolism (73)
- ABC transporters (72)
- Renin-angiotensin system (70)
- Butanoate metabolism (69)
- Cytosolic DNA-sensing pathway (69)
- Tryptophan metabolism (69)
- Homologous recombination (67)
- Tyrosine metabolism (67)
- Propanoate metabolism (64)
- Allograft rejection (63)
- Fatty acid metabolism (62)
- Graft-versus-host disease (58)
- Systemic lupus erythematosus (58)
- Notch signaling pathway (56)
- Pyruvate metabolism (53)
- beta-Alanine metabolism (50)
- Proteasome (47)
- Glutathione metabolism (45)
- Linoleic acid metabolism (45)
- Lysine degradation (45)
- Drug metabolism - other enzymes (44)
- Vibrio cholerae infection (43)
- Sphingolipid metabolism (42)
- One carbon pool by folate (40)
- Pentose phosphate pathway (40)
- Cardiac muscle contraction (39)
- Fructose and mannose metabolism (39)
- Galactose metabolism (37)
- Histidine metabolism (37)
- Primary bile acid biosynthesis (35)
- Taste transduction (35)
- Folate biosynthesis (34)
- Starch and sucrose metabolism (32)
- Other glycan degradation (31)
- Oxidative phosphorylation (31)
- SNARE interactions in vesicular transport (29)
- Citrate cycle (TCA cycle) (28)
- Asthma (26)
- Circadian rhythm - mammal (26)
- Maturity onset diabetes of the young (26)
- RNA degradation (25)
- Spliceosome (25)
- Caffeine metabolism (24)
- Cysteine and methionine metabolism (23)
- Amino sugar and nucleotide sugar metabolism (22)
- Glycerophospholipid metabolism (22)
- Nitrogen metabolism (22)
- Olfactory transduction (20)
- Phenylalanine metabolism (20)
- Regulation of autophagy (20)
- Androgen and estrogen metabolism (19)
- Ribosome (19)
- Glycosaminoglycan degradation (18)
- Glycine (17)
- Synthesis and degradation of ketone bodies (17)
- serine and threonine metabolism (17)
- Non-homologous end-joining (15)
- Methane metabolism (14)
- Terpenoid backbone biosynthesis (14)
- Sulfur metabolism (13)
- Fatty acid biosynthesis (12)
- Pantothenate and CoA biosynthesis (12)
- Porphyrin and chlorophyll metabolism (12)
- Ascorbate and aldarate metabolism (11)
- C21-Steroid hormone metabolism (11)
- Selenoamino acid metabolism (11)
- Limonene and pinene degradation (10)
- Taurine and hypotaurine metabolism (10)
- Pentose and glucuronate interconversions (9)
- Glycosphingolipid biosynthesis - ganglio series (8)
- Glyoxylate and dicarboxylate metabolism (8)
- Nicotinate and nicotinamide metabolism (8)
- Ether lipid metabolism (7)
- leucine and isoleucine biosynthesis (7)
- Biosynthesis of unsaturated fatty acids (6)
- Riboflavin metabolism (6)
- Steroid biosynthesis (5)
- Aminoacyl-tRNA biosynthesis (4)
- Basal transcription factors (4)
- Fatty acid elongation in mitochondria (4)
- Vitamin B6 metabolism (4)
- Glycosphingolipid biosynthesis - globo series (3)
- D-Glutamine and D-glutamate metabolism (2)
- Protein export (2)
- alpha-Linolenic acid metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- Phenylalanine (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)