Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 399.00
In Stock
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
TIGIT mouse monoclonal antibody, clone OTI8G7
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 380.00
In Stock
Active filters
Category
- Antibodies
Applications
- IHC
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- MSMB (51)
- KLK8 (47)
- ERBB2 (45)
- PECAM1 (43)
- ABCB1 (34)
- PTPRC (33)
- CD4 (32)
- CD99 (32)
- EPCAM (30)
- MLANA (28)
- PDCD1 (27)
- MS4A1 (26)
- NCAM1 (25)
- CD68 (24)
- PROCR (23)
- KIT (22)
- CD163 (20)
- MUC1 (20)
- RET (20)
- APP (19)
- SYP (19)
- CD44 (18)
- CDH1 (18)
- NPR3 (18)
- APMAP (17)
- BCL2 (17)
- CD40 (17)
- CR2 (17)
- CYP1A2 (17)
- TNFRSF8 (17)
- BSG (16)
- CD1C (16)
- PDCD1LG2 (16)
- ACE2 (15)
- CD2 (15)
- EGFR (15)
- FCGR2A (15)
- FOLH1 (15)
- MME (15)
- PTPRE (15)
- LGR5 (14)
- TAPBPL (14)
- CD19 (13)
- CD63 (13)
- CD80 (13)
- FCER2 (13)
- GPR17 (13)
- L1CAM (13)
- MCAM (13)
- SYT4 (13)
- ANO1 (12)
- FBXW7 (12)
- FGG (12)
- MTDH (12)
- ROS1 (12)
- UBE2J1 (12)
- CD34 (11)
- ENPEP (11)
- ERBB3 (11)
- FGFR2 (11)
- GOLM1 (11)
- MSR1 (11)
- PCDH7 (11)
- PMEL (11)
- ROR2 (11)
- VIP (11)
- CD274 (10)
- CD79B (10)
- GPA33 (10)
- POR (10)
- SEMA4D (10)
- SRPRB (10)
- WFDC2 (10)
- ANPEP (9)
- CA12 (9)
- CD14 (9)
- CD22 (9)
- CD74 (9)
- CD8A (9)
- CSF2RB (9)
- FATE1 (9)
- FCGR1A (9)
- HGF (9)
- MCL1 (9)
- SLC2A5 (9)
- SLC7A8 (9)
- TNFRSF10B (9)
- WNT3 (9)
- AQP8 (8)
- BAX (8)
- BTLA (8)
- CD5 (8)
- ICOSLG (8)
- IFITM2 (8)
- IGSF11 (8)
- PODXL (8)
- PON3 (8)
- RPN1 (8)
- SCAMP2 (8)
- SCARB1 (8)
Reactivities
- Human (3385)
- Mouse (1718)
- Rat (1561)
- Monkey (137)
- Dog (121)
- Gorilla (24)
- Bovine (18)
- Gibbon (15)
- Pig (15)
- Rabbit (14)
- Horse (10)
- Hamster (9)
- Chicken (8)
- Chimpanzee (7)
- Orang-Utan (6)
- Bat (5)
- Cow (4)
- Guinea Pig (4)
- Zebrafish (4)
- Rhesus Monkey (3)
- Primate (2)
- X. tropicalis (2)
- Xenopus (2)
- Goat (1)
- Mink (1)
- Opossum (1)
- Pufferfish (1)
- Sheep (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Cell adhesion molecules (CAMs) (442)
- Hematopoietic cell lineage (330)
- Pathways in cancer (264)
- Cytokine-cytokine receptor interaction (258)
- Metabolic pathways (175)
- Calcium signaling pathway (148)
- Endocytosis (142)
- Neuroactive ligand-receptor interaction (135)
- Leukocyte transendothelial migration (130)
- Focal adhesion (128)
- T cell receptor signaling pathway (120)
- Primary immunodeficiency (118)
- Adherens junction (114)
- Prostate cancer (104)
- MAPK signaling pathway (102)
- Alzheimer's disease (87)
- Bladder cancer (86)
- Pancreatic cancer (83)
- Endometrial cancer (82)
- ErbB signaling pathway (82)
- Regulation of actin cytoskeleton (82)
- Colorectal cancer (80)
- Apoptosis (76)
- Systemic lupus erythematosus (68)
- Toll-like receptor signaling pathway (68)
- Melanogenesis (66)
- Melanoma (65)
- Non-small cell lung cancer (65)
- ABC transporters (61)
- Axon guidance (61)
- Fc gamma R-mediated phagocytosis (61)
- Antigen processing and presentation (57)
- Jak-STAT signaling pathway (57)
- B cell receptor signaling pathway (56)
- Renin-angiotensin system (55)
- Lysosome (53)
- Amyotrophic lateral sclerosis (ALS) (52)
- ECM-receptor interaction (50)
- Neurotrophin signaling pathway (49)
- Thyroid cancer (45)
- Allograft rejection (44)
- Drug metabolism - cytochrome P450 (43)
- Gap junction (43)
- Viral myocarditis (43)
- Autoimmune thyroid disease (41)
- Natural killer cell mediated cytotoxicity (41)
- Complement and coagulation cascades (40)
- Parkinson's disease (37)
- Huntington's disease (36)
- Pathogenic Escherichia coli infection (34)
- Prion diseases (34)
- Retinol metabolism (34)
- Wnt signaling pathway (34)
- Dilated cardiomyopathy (32)
- Linoleic acid metabolism (32)
- Metabolism of xenobiotics by cytochrome P450 (31)
- Glioma (30)
- Tight junction (30)
- Adipocytokine signaling pathway (29)
- Epithelial cell signaling in Helicobacter pylori infection (29)
- GnRH signaling pathway (29)
- Hypertrophic cardiomyopathy (HCM) (29)
- TGF-beta signaling pathway (29)
- Basal cell carcinoma (28)
- Graft-versus-host disease (28)
- Type I diabetes mellitus (28)
- Small cell lung cancer (27)
- Vascular smooth muscle contraction (27)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (26)
- Asthma (26)
- Chemokine signaling pathway (26)
- N-Glycan biosynthesis (26)
- PPAR signaling pathway (25)
- Ubiquitin mediated proteolysis (25)
- Caffeine metabolism (24)
- Acute myeloid leukemia (23)
- SNARE interactions in vesicular transport (22)
- Tryptophan metabolism (22)
- p53 signaling pathway (22)
- Hedgehog signaling pathway (21)
- Renal cell carcinoma (19)
- Arachidonic acid metabolism (18)
- Chronic myeloid leukemia (18)
- Long-term potentiation (18)
- Oxidative phosphorylation (18)
- Type II diabetes mellitus (18)
- Dorso-ventral axis formation (17)
- Cardiac muscle contraction (15)
- Purine metabolism (15)
- RIG-I-like receptor signaling pathway (15)
- Taste transduction (14)
- Nitrogen metabolism (13)
- Fatty acid metabolism (12)
- Glutathione metabolism (12)
- Long-term depression (12)
- Sphingolipid metabolism (12)
- Drug metabolism - other enzymes (11)
- Notch signaling pathway (11)
- Oocyte meiosis (10)
- Porphyrin and chlorophyll metabolism (10)
- Tyrosine metabolism (10)
- Riboflavin metabolism (9)
- Vibrio cholerae infection (9)
- Fc epsilon RI signaling pathway (8)
- NOD-like receptor signaling pathway (8)
- Nicotinate and nicotinamide metabolism (8)
- Steroid biosynthesis (8)
- Androgen and estrogen metabolism (7)
- Glycerolipid metabolism (7)
- Insulin signaling pathway (7)
- Progesterone-mediated oocyte maturation (7)
- Biosynthesis of unsaturated fatty acids (6)
- Cytosolic DNA-sensing pathway (6)
- Glycosphingolipid biosynthesis - lacto and neolacto series (6)
- Pyrimidine metabolism (6)
- Ascorbate and aldarate metabolism (5)
- Keratan sulfate biosynthesis (5)
- O-Glycan biosynthesis (5)
- Other glycan degradation (5)
- Primary bile acid biosynthesis (5)
- Propanoate metabolism (5)
- Valine (5)
- leucine and isoleucine degradation (5)
- Arginine and proline metabolism (4)
- Chondroitin sulfate biosynthesis (4)
- Glycerophospholipid metabolism (4)
- Histidine metabolism (4)
- Phosphatidylinositol signaling system (4)
- Starch and sucrose metabolism (4)
- Butanoate metabolism (3)
- C21-Steroid hormone metabolism (3)
- Ether lipid metabolism (3)
- Glycolysis / Gluconeogenesis (3)
- Inositol phosphate metabolism (3)
- Limonene and pinene degradation (3)
- Lysine degradation (3)
- Pyruvate metabolism (3)
- beta-Alanine metabolism (3)
- Heparan sulfate biosynthesis (2)
- Olfactory transduction (2)
- Pantothenate and CoA biosynthesis (2)
- Pentose and glucuronate interconversions (2)
- Protein export (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Base excision repair (1)
- Cell cycle (1)
- Cyanoamino acid metabolism (1)
- Glycine (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Phenylalanine metabolism (1)
- Selenoamino acid metabolism (1)
- Sulfur metabolism (1)
- Taurine and hypotaurine metabolism (1)
- Terpenoid backbone biosynthesis (1)
- VEGF signaling pathway (1)
- serine and threonine metabolism (1)