Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Anti-LGR5 mouse mAb, clone OTI2A2, PE conjugated
Applications | FC, IHC |
Reactivities | Human, Mouse |
Conjugation | PE |
Carrier-free (BSA/glycerol-free) CD1C mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTLA4 mouse monoclonal antibody,clone UMAB249
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Purified CD20 (MS4A1) mouse monoclonal antibody,clone UMAB58
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Carrier-free (BSA/glycerol-free) CD20 mouse monoclonal antibody,clone UMAB38
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GPA33 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GPA33 |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal RHBDD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2. |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against CD317 / BST2
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ELOVL5 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL5. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
TIGIT mouse monoclonal antibody, clone OTI8G7
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARC |
Rabbit Polyclonal Anti-TNFSF13B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFSF13B |
Rabbit Polyclonal Anti-CRTAM Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CRTAM |
Rabbit Polyclonal Anti-LAMP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LAMP2 |
Rabbit Polyclonal Anti-ITGB3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB3 |
Rabbit Polyclonal Antibody against SR-BI
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mink, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A C-terminal peptide containing residues from mouse Scavenger Receptor-BI (within residues 450-509). |
Rabbit polyclonal antibody to Bcl-B (BCL2-like 10 (apoptosis facilitator))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 60 and 153 of BCL2L10 (Uniprot ID#Q9HD36) |
Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
Modifications | Phospho-specific |
CD19 mouse monoclonal antibody,clone 3B10, PE conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | PE |
Rabbit Polyclonal Prostate Secretory Protein/PSP Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
Rabbit polyclonal antibody to GPR120 (G protein-coupled receptor 120)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 71 of GPR120 (Uniprot ID#Q5NUL3) |
Mouse Monoclonal anti-CACNA1C Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-APP Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APP |
Rabbit Polyclonal Anti-IL20RA Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL20RA |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APLNR |
Rabbit Polyclonal Anti-BMPR1B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BMPR1B |
USD 380.00
In Stock
Rabbit Polyclonal Anti-CCL4 Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL4 |
Rabbit Polyclonal Anti-CCL25 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CCL25 |
Rabbit Polyclonal Anti-CHRM1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRM1 |
Rabbit Polyclonal Anti-CMTM2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CMTM2 |
Rabbit Polyclonal Anti-ENPP5 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENPP5 |
Rabbit Polyclonal Anti-SCARB1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SCARB1 |
Rabbit Polyclonal Anti-LILRB1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB1 |