Antibodies

View as table Download

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB

Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172)

TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TYR

Tyrosinase (TYR) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 486-513 amino acids from the C-terminal region of Human Tyrosinase.

Dopamine beta Hydroxylase (DBH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 27-56 amino acids from the N-terminal region of Human DBH.

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).

Anti-COMT Goat Polyclonal Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%).

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

TRP2 (DCT) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 62-89 amino acids from the N-terminal region of human DCT.

TRP2 (DCT) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 62-89 amino acids from the N-terminal region of Human DCT

Goat Anti-AOC3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1.

Rabbit polyclonal AOC3 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3.

Goat Polyclonal Antibody against thyroid peroxidase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1.

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Rabbit (93%); Horse (87%); Mouse, Rat, Hamster, Bat, Pig (80%).

Rabbit Polyclonal Anti-COMT Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from N-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Marmoset (89%); Hamster (84%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 15 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Pig (100%); Hamster, Elephant, Panda, Rabbit, Horse (93%); Dog, Turkey, Chicken, Xenopus (87%).

Rabbit Polyclonal Anti-COMT Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from internal region of human COMT. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Orangutan, Gibbon, Rabbit (95%); Monkey, Marmoset, Horse (89%); Mouse, Rat, Hamster (84%).

Rabbit Polyclonal Anti-COMT Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen COMT antibody was raised against synthetic 19 amino acid peptide from C-terminus of human COMT. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Hamster, Rabbit (84%).

Anti-TPO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase

Anti-DCT Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase

Anti-DCT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase

Rabbit Polyclonal Anti-DBH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DBH