USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-DLD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DLD |
Rabbit Polyclonal Anti-DLD Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-MAOA Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOA |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal Anti-ALAS2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ |
Rabbit Polyclonal antibody to Glycine dehydrogenase (glycine dehydrogenase (decarboxylating))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 442 and 723 of Glycine dehydrogenase (Uniprot ID#P23378) |
PHGDH mouse monoclonal antibody, clone 4A3-1D6, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
CBSL mouse monoclonal antibody, clone 3E1, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Rat |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
CBSL mouse monoclonal antibody, clone 6B8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CBSL mouse monoclonal antibody, clone 6A9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CBSL mouse monoclonal antibody, clone 5F7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
Lipoamide Dehydrogenase (DLD) mouse monoclonal antibody, clone 3C1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
Lipoamide Dehydrogenase (DLD) mouse monoclonal antibody, clone 1G11, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
Lipoamide Dehydrogenase (DLD) mouse monoclonal antibody, clone 2D4, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Monoamine Oxidase A (MAOA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected between amino acids 70 and 100 of Human Glycine amidinotransferase |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBS |
Rabbit Polyclonal Anti-DLD Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DLD |
GLDC Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGT |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |