Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 64 results

Page 1 of 2

(reset)

E2F3 Rabbit Polyclonal Antibody

TA349084

USD 484.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.

1 / 3

2 / 3

3 / 3

Previous Next

Rb (RB1) Rabbit Polyclonal Antibody

TA333284

USD 352.00

3 Weeks

Phospho-RB1-S780 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding S780 of human RB1
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

MDM2 Rabbit Polyclonal Antibody

TA302211

USD 450.00

In Stock

Rabbit Polyclonal Antibody against MDM2 (C-term)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA327567

USD 345.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human TP53

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MSK1 (RPS6KA5) Rabbit Polyclonal Antibody

TA312503

USD 345.00

In Stock

Rabbit polyclonal MSK1 (Ab-212) antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human MSK1.

1 / 2

2 / 2

Previous Next

MSK1 (RPS6KA5) Rabbit Polyclonal Antibody

TA312506

USD 345.00

In Stock

Rabbit polyclonal MSK1 (Ser212) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human MSK1 around the phosphorylation site of serine 212 (A-Y-SP-F-C).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

Rb (RB1) Rabbit Polyclonal Antibody

TA314432

USD 345.00

In Stock

Rabbit polyclonal Retinoblastoma (Ser608) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Retinoblastoma around the phosphorylation site of serine 608 (Y-L-SP-P-V).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

Rb (RB1) Rabbit Polyclonal Antibody

TA323698

USD 345.00

4 Weeks

Anti-RB1 (Phospho-Ser795) Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide sequence around phosphorylation site of serine 795 (P-S-S(p)-P-L) derived from Human Rb.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA326222

USD 345.00

In Stock

Rabbit polyclonal MYC antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 424.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA324776

USD 450.00

5 Days

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications	Dot, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA325703

USD 345.00

4 Weeks

Rabbit Polyclonal C-myc antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human C-myc

1 / 2

2 / 2

Previous Next

E2F2 Rabbit Polyclonal Antibody

TA343440

USD 375.00

5 Days

Rabbit Polyclonal Anti-E2F2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2. Synthetic peptide located within the following region: DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA302042

USD 450.00

5 Days

Rabbit Polyclonal Antibody against MYC (T58)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

1 / 2

2 / 2

Previous Next

Rb (RB1) Rabbit Polyclonal Antibody

TA323699

USD 345.00

4 Weeks

Anti-RB1 (Phospho-Ser807) Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide sequence around phosphorylation site of serine 807 (Y-I-S(p)-P-L) derived from Human Rb.
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

MDM2 Rabbit Polyclonal Antibody

TA325681

USD 345.00

4 Weeks

Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166.
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: 172C1094]

TA336425

USD 424.00

5 Days

Mouse Monoclonal cleaved Retinoblastoma 1 Antibody (172C1094)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354205

USD 300.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the N-terminus of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354509

USD 325.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA354572

USD 355.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein

1 / 2

2 / 2

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: S20]

TA354364

USD 355.00

5 Days

Mouse anti p53 Monoclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF500002

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

CF500003

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

CF500004

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

CF502870

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

CF502987

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI11C10]

CF805623

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RB1 mouse monoclonal antibody,clone OTI11C10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI13A6]

CF805640

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RB1 mouse monoclonal antibody,clone OTI13A6

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI3F11]

CF805656

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RB1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI10H9]

CF805671

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RB1 mouse monoclonal antibody, clone OTI10H9 (formerly 10H9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

TA500003AM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F2]

TA500003BM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003S

USD 159.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G3]

TA500004AM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G3]

TA500004BM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

TA502870

USD 379.00

In Stock

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E2]

TA502870AM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E2]

TA502870BM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

TA502870S

USD 159.00

In Stock

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

TA502987

USD 379.00

In Stock

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D11]

TA502987AM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D11]

TA502987BM

USD 420.00

4 Weeks

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI1D11]

TA502987S

USD 159.00

2 Days

TP53 mouse monoclonal antibody, clone OTI1D11 (formerly 1D11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI11C10]

TA805623

USD 379.00

In Stock

RB1 mouse monoclonal antibody,clone OTI11C10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Rb (RB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI11C10]

TA805623AM

USD 420.00

4 Weeks

RB1 mouse monoclonal antibody,clone OTI11C10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

1 - 50 of 64 results

Page 1 of 2