beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JUN |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone EM-22, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Hamster, Human, Mouse |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
Rabbit polyclonal JUN Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal c-Jun (Phospho-Ser63) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63. |
Modifications | Phospho-specific |
Rabbit Polyclonal ELK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
p38 (CRK) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal Catenin-beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1. |
Rabbit polyclonal Elk-1(Ab-383) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human Elk-1 around the phosphorylation site of Serine 383. |
Rabbit polyclonal Phospho-cJun(S63) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser243) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I). |
Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Ab-170) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170. |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
Applications | IF, IHC, WB |
Reactivities | Chicken, Human, Rat |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
c-Jun (JUN) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
Immunogen | JUN antibody was raised against synthetic peptide derived from the sequence of human c-Jun, conjugated to KLH |
Rabbit polyclonal beta Catenin antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Anti-ELK1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.387~391 (P-R-S-P-A) derived from Human Elk1. |
Rabbit polyclonal Phospho-cJun(S63) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Ab-243) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243. |
Rabbit Polyclonal Anti-JUN Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Mouse Monoclonal beta-Catenin Antibody (12F7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Chicken, Primate |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) pSer33 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
p38 (CRK) (CRK-II, pTry221) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal antibody to VAV1 (vav 1 guanine nucleotide exchange factor)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 83 and 568 of VAV1 (Uniprot ID#P15498) |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
Modifications | Phospho-specific |
Anti-ELK1 (Phospho-Ser389) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 389 (P-R-S(p)-P-A) derived from Human Elk-1. |
Modifications | Phospho-specific |
beta Catenin (CTNNB1) pSer33/37/pThr41 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) pThr41/pSer45 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
p38 (CRK) (CRK-II) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 200-250 of Human Crk2. |
Rabbit anti-ELK1 (Phospho-Thr417) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanElk-1 around the phosphorylation site of threonine 417 (L-S-TP-P-V). |
Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9H2 (formerly 9H2)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9F6 (formerly 9F6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JUN mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JUN mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |