Antibodies

View as table Download

Rabbit Polyclonal Anti-ACO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Rabbit Polyclonal antibody to MDH2 (malate dehydrogenase 2, NAD (mitochondrial))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 40 and 319 of MDH2 (Uniprot ID#P40926)

Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390)

Goat Polyclonal Anti-Aconitase 2 (aa541-555) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aconitase 2 (aa541-555) Antibody: Peptide with sequence C-QDTYQHPPKDSSGQH, from the internal region of the protein sequence according to NP_001089.1.

Rabbit Polyclonal Anti-GRHPR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRHPR antibody: synthetic peptide directed towards the N terminal of human GRHPR. Synthetic peptide located within the following region: EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH

Rabbit polyclonal anti-GLCTK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLCTK.

PGP (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 40~70 amino acids from the N-terminal region of human PGP

Rabbit Polyclonal Antibody against ACO2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACO2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 294-325 amino acids from the Central region of human ACO2.

Mouse Anti-Human MDH2 Monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-ACO2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 766-780 amino acids of human aconitase 2, mitochondrial

HYI mouse monoclonal antibody, clone 2A2

Applications ELISA, IHC, WB
Reactivities Human

Rabbit polyclonal MTHFD2 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2.

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD

Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Aconitase 1 (ACO1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R).
Modifications Phospho-specific

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG

Carrier-free (BSA/glycerol-free) ACO2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI10A3 (formerly 10A3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GRHPR mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ACO2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 766-780 amino acids of human aconitase 2, mitochondrial

Anti-ACO1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble

Anti-ACO1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble

Anti-ACO2 (Aconitase 2) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ACO2 (Aconitase 2) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-ACO2 (Aconitase 2) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-ACO2 (Aconitase 2) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GRHPR mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GRHPR mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI10A3 (formerly 10A3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI10A3 (formerly 10A3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GRHPR mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin