Antibodies

View as table Download

PBR (TSPO) (C-term) goat polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide C-RDNSGRRGGSRLPE from the C-terminus of Mouse TSPO (NP_033905.3).
Percent identity with other species by BLAST analysis: Mouse (100%), Rat (93%). 
C-Terminus

Rabbit Polyclonal Anti-P2Y1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide SDEYLRSYFIYSMC, corresponding to amino acid residues 207-220 of human P2Y1 Receptor. 2nd extracellular loop.

Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, WB
Reactivities Rat
Immunogen D2s (Ac239-Cys247) covalently attached to a carrier protein

Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Conjugation Unconjugated
Immunogen DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%).

Rabbit polyclonal Anti-P2X1 Receptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CRPIYEFHGLYEEK, corresponding to amino acid residues 270-283 of human P2X1 receptor . Extracellular loop.

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW

LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated

P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6

LGR7 (RXFP1) (609-624) rabbit polyclonal antibody, Serum

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic Human Relaxin Receptor 1 (aa 609-624) KLH-conjugated

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).

Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus.

Anti-S1PR3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 222-236 amino acids of human sphingosine-1-phosphate receptor 3

Anti-MTNR1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 130-144 amino acids of human melatonin receptor 1A

Anti-SSTR3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 405-418 amino acids of human somatostatin receptor 3

Rabbit Polyclonal Anti-CALCRL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALCRL