Antibodies

View as table Download

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1

Rabbit Polyclonal anti-TLR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Developed against a synthetic peptide corresponding to amino acids 420-435 of human TLR4.

Rabbit anti-CDH1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CDH1

Rabbit Polyclonal Anti-TLR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TLR4

Rabbit Polyclonal Antibody against CD14 (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14.

Rabbit Polyclonal Antibody against CD14 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CD14.

Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V).
Modifications Phospho-specific

Rabbit Anti-Human TLR5 Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against synthetic peptide from human TLR5.

Rabbit Polyclonal TLR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the mouse TLR4 protein (between residues 400-450) [NP_612564]

Rabbit Polyclonal TLR4 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was developed against a sythetic peptide corresponding to amino acids 420-456 of human TLR4.

Rabbit Polyclonal TLR5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLR5 antibody was raised against a peptide corresponding to 16 amino acids near the center of human TLR5.

Rabbit Polyclonal TLR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal portion of the human TLR4 protein (between residues 650-710) [UniProt O00206]

Rabbit Polyclonal TLR5 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5.

Rabbit polyclonal anti-Claudin 1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 1.

Rabbit Polyclonal E-cadherin Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human E-cadherin

Rabbit Polyclonal Anti-CLDN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

Rabbit anti Claudin 1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human claudin 1 protein.

Rabbit Polyclonal TLR4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TLR4 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TLR4.

Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%).

Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Dog, Bovine, Cat, Elephant, Panda, Horse, Pig (100%); Platypus (93%); Bat, Opossum (86%).

Anti-CDH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 773-787 amino acids of Human cadherin 1, type 1, E-cadherin (epithelial)

Anti-pan CDH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin

Anti-pan CDH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1

Anti-CLDN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1

Rabbit Polyclonal Anti-TLR4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR4

Rabbit Polyclonal Anti-TLR5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR5