Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-MAPK8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human mitogen-activated protein kinase 8 |
Rabbit Polyclonal FSH Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ADCY3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADCY3 |
Rabbit Polyclonal Anti-PLA2G4A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLA2G4A |
Rabbit Polyclonal Anti-MAPK12 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAPK12 |
Rabbit Polyclonal Anti-MAPK11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPK11 |
Rabbit Polyclonal Anti-MAPK13 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPK13 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal Anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CACNA1C |
USD 345.00
In Stock
Rabbit Polyclonal Anti-PLA2G6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLA2G6 |
Rabbit Polyclonal Anti-ITPR2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ITPR2 |
Rabbit Polyclonal Anti-ITPR3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ITPR3 |
GNRH2 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV |
GNRH1 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Pathways
- GnRH signaling pathway
Filter by
Target Symbol
- JUN (10)
- EGFR (8)
- GNAS (7)
- MAP2K6 (6)
- MAPK14 (6)
- MMP2 (6)
- SRC (6)
- ELK1 (5)
- PRKCA (5)
- PRKCD (5)
- PTK2B (5)
- RAF1 (5)
- MAPK1 (4)
- ATF4 (3)
- CAMK2B (3)
- GNRH1 (3)
- GRB2 (3)
- MAP2K1 (3)
- MAP2K2 (3)
- MAP2K4 (3)
- MAP3K4 (3)
- MAPK8 (3)
- MMP14 (3)
- NRAS (3)
- ADCY1 (2)
- ADCY4 (2)
- ADCY5 (2)
- CACNA1C (2)
- CAMK2A (2)
- GNA11 (2)
- GNRHR (2)
- HRAS (2)
- LHB (2)
- MAPK3 (2)
- MAPK7 (2)
- MAPK9 (2)
- PLCB3 (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- CACNA1D (1)
- CACNA1S (1)
- CALM1 (1)
- CALML5 (1)
- CDC42 (1)
- CGA (1)
- FSHB (1)
- GNRH2 (1)
- ITPR1 (1)
- ITPR2 (1)
- ITPR3 (1)
- MAP2K3 (1)
- MAP2K7 (1)
- MAP3K1 (1)
- MAP3K2 (1)
- MAPK10 (1)
- MAPK11 (1)
- MAPK12 (1)
- MAPK13 (1)
- PLA2G3 (1)
- PLA2G4A (1)
- PLA2G4E (1)
- PLA2G6 (1)
- PLCB1 (1)
- PLCB2 (1)
- PLD2 (1)
- PRKACB (1)