Antibodies

View as table Download

Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2.

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Rabbit Polyclonal Anti-GAPDH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GAPDH

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications Assay, IF, IHC, WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2]

Rabbit Polyclonal GAPDH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH.

GAPDH rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mammalian, Mouse, Rat
Immunogen Purified recombinant human GAPDH

Rabbit polyclonal GAPDH Antibody (C-term R248)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH.

GAPDH sheep polyclonal antibody, Ig Fraction

Applications ELISA, IHC, WB
Reactivities Escherichia coli, Human, Rabbit
Immunogen GAPDH antibody was raised against GAPDH synthetic peptide

GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Drosophila, Human, Mouse, Rat
Immunogen Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH

GAPDH rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mammalian, Mouse, Rat
Immunogen Purified recombinant human GAPDH

Rabbit polyclonal GAPDH Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-91 amino acids from the N-terminal region of human GAPDH.

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Primate, Rat
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to a region between residues 150 and 200 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597).

Rabbit Polyclonal Anti-PCK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PCK2