PPARG Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human PPARG |
PPARG Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N term -peptide of human PPARG |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
Rabbit anti-PPARD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPARD |
Rabbit Polyclonal LXR-A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A. |
Rabbit Polyclonal PPAR gamma/NR1C3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PPAR gamma protein (between residues 20-120) [UniProt P37231] |
Rabbit Polyclonal Anti-PPARD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS |
Rabbit Polyclonal Anti-PPARD Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI4D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PPARA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha |
Anti-PPARG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma |
Anti-PPARG Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma |
Anti-PPARD Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of human peroxisome proliferator-activated receptor delta |
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PPARD mouse monoclonal antibody,clone OTI4D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPARD mouse monoclonal antibody,clone OTI4D10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".