Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit polyclonal CDC25A (Ser75) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | H:S76, M:S74, R:S76 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of Ser75 |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
| Modifications | Phospho-specific |
Anti-PTPN11 (Phospho-Tyr542) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 542 (H-E-Y(p)-T-N) derived from Human SHP-2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-EYA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
Rabbit polyclonal MKP1 (Ser359) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PPP1R1C antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP1R1C. |
PTPRM Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
Mouse Monoclonal CD45R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DUSP22 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DUSP22 / JSP 1 antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human DUSP22. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit (100%); Mouse, Rat (94%); Elephant, Chicken (88%); Xenopus (82%). |
Mouse anti Prostate Specific Acid Phosphatase Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP23 mouse monoclonal antibody, clone OTI3C10 (formerly 3C10)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Phosphatase
Filter by
Category
Target Symbol
- PTPRC (50)
- PTPRE (29)
- PPP4C (12)
- CTDSP1 (11)
- PTPN1 (10)
- PTEN (8)
- CDKN3 (7)
- PTPN7 (7)
- CDC25A (6)
- CTDSP2 (6)
- PPP2R5D (6)
- PPP1CA (5)
- DUSP10 (4)
- DUSP23 (4)
- PPP1CB (4)
- PPP2R1B (4)
- PPP3CA (4)
- PTPN22 (4)
- PTPN6 (4)
- SIRPA (4)
- CDC25B (3)
- CDC25C (3)
- DAPP1 (3)
- DUSP1 (3)
- DUSP29 (3)
- DUSP6 (3)
- PPM1B (3)
- PPP1R7 (3)
- PPP4R4 (3)
- PTP4A2 (3)
- PTPN11 (3)
- PTPRJ (3)
- PTPRM (3)
- DUSP12 (2)
- DUSP16 (2)
- DUSP22 (2)
- DUSP4 (2)
- DUSP8 (2)
- PPM1F (2)
- PPP1CC (2)
- PPP2CB (2)
- PTPN13 (2)
- PTPRK (2)
- SET (2)
- SSH3 (2)
- ACP1 (1)
- ACPP (1)
- CTDSPL (1)
- DUSP11 (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP26 (1)
- DUSP3 (1)
- DUSP7 (1)
- EYA1 (1)
- EYA3 (1)
- ILKAP (1)
- MTMR4 (1)
- MTMR7 (1)
- MTMR9 (1)
- PDP1 (1)
- PPFIA1 (1)
- PPM1K (1)
- PPP1R1C (1)
- PPP2CA (1)
- PPP2R1A (1)
- PPP2R2A (1)
- PPP2R3A (1)
- PPP3CB (1)
- PTPN12 (1)
- PTPN2 (1)
- PTPN20 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPN5 (1)
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- T cell receptor signaling pathway (59)
- Cell adhesion molecules (CAMs) (53)
- Fc gamma R-mediated phagocytosis (50)
- Primary immunodeficiency (50)
- MAPK signaling pathway (39)
- Oocyte meiosis (33)
- Adherens junction (21)
- Insulin signaling pathway (21)
- Focal adhesion (19)
- Wnt signaling pathway (19)
- Tight junction (17)
- Long-term potentiation (16)
- Regulation of actin cytoskeleton (13)
- B cell receptor signaling pathway (12)
- Cell cycle (12)
- Natural killer cell mediated cytotoxicity (12)
- Progesterone-mediated oocyte maturation (12)
- Vascular smooth muscle contraction (11)
- Endometrial cancer (8)
- Glioma (8)
- Inositol phosphate metabolism (8)
- Long-term depression (8)
- Melanoma (8)
- Pathways in cancer (8)
- Phosphatidylinositol signaling system (8)
- Prostate cancer (8)
- Small cell lung cancer (8)
- TGF-beta signaling pathway (8)
- p53 signaling pathway (8)
- Jak-STAT signaling pathway (7)
- Alzheimer's disease (5)
- Amyotrophic lateral sclerosis (ALS) (5)
- Apoptosis (5)
- Axon guidance (5)
- Calcium signaling pathway (5)
- VEGF signaling pathway (5)
- Adipocytokine signaling pathway (3)
- Chronic myeloid leukemia (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Leukocyte transendothelial migration (3)
- Neurotrophin signaling pathway (3)
- Renal cell carcinoma (3)
- Riboflavin metabolism (3)
- Fructose and mannose metabolism (1)
- Metabolic pathways (1)
- Thiamine metabolism (1)