Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Carrier-free (BSA/glycerol-free) IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IFNA16 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IFNA16 |
IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL12B mouse monoclonal antibody, clone OTI8B9 (formerly 8B9)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
