Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-CLDN11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit Polyclonal Integrin alpha M/CD11b Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region (within residues 250-350) of the mouse CD11b protein. [Swiss-Prot# P05555] |
Rabbit anti-CD99 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD99 |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Claudin 7 (Ab-210) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V). |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit polyclonal Claudin 5 (Tyr217) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Claudin 5 around the phosphorylation site of tyrosine 217 (K-N-YP-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NOX3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NOX3. |
Rabbit Polyclonal Anti-CLDN17 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17. Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA |
Rabbit Polyclonal Anti-CLDN8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN8 antibody: synthetic peptide directed towards the C terminal of human CLDN8. Synthetic peptide located within the following region: IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV |
Rabbit Polyclonal Anti-CLDN1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN1 antibody: synthetic peptide directed towards the C terminal of human CLDN1. Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Mouse Monoclonal VCAM-1/CD106 Antibody (6G9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336775 is a replacement of AM06443SU-N.
Rabbit Polyclonal Anti-CXCR4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CXCR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Rabbit, Opossum, Turkey, Chicken, Platypus, Lizard (100%). |
Rabbit Polyclonal Anti-CXCR4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Tamarin, Mouse, Rat, Bat, Bovine, Dog, Cat, Hamster, Panda, Rabbit, Horse, Pig, Opossum, Lizard (100%); Elephant, Turkey, Chicken (94%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Dog, Bovine, Cat, Elephant, Panda, Horse, Pig (100%); Platypus (93%); Bat, Opossum (86%). |
Rabbit Polyclonal Anti-ITGA4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA4 / VLA-4 / CD49d antibody was raised against synthetic 14 amino acid peptide from internal region of human ITGA4 / VLA-4. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Gibbon (100%), Monkey (100%), Marmoset (100%), Mouse (100%), Rat (100%), Elephant (93%), Panda (93%), Dog (86%), Bat (86%), Bovine (86%), Rabbit (86%), Horse (86%), Pig (86%). |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Leukocyte transendothelial migration