Rabbit polyclonal GR (Ser211) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-SP-P-W). |
| Modifications | Phospho-specific |
GRPR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Dog, Bat, Pig (100%); Panda, Rabbit, Opossum (94%); Horse (88%); Turkey, Chicken, Lizard (82%). |
HTR6 / 5-HT6 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Dog, Gorilla, Hamster, Horse, Human, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | HTR6 / 5-HT6 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human HTR6 / 5-HT36. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Horse (100%); Mouse, Elephant, Bovine, Bat, Rabbit (94%); Stickleback, Pufferfish (88%); Turkey, Chicken, Xenopus, Zebrafish (82%). |
NPFF1 / NPFFR1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | NPFFR1 / GPR147 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human NPFF1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Horse, Rabbit, Pig (100%); Mouse, Rat, Dog, Panda (95%); Elephant, Turkey, Chicken (85%); Opossum, Platypus (80%). |
CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%). |
Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%). |
USD 410.00
5 Days
Rabbit Polyclonal Anti-M1 Muscarinic Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with a sequence GSETPGKGGGSSSSSERSQP GAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSS EGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDR AGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human m1.3rd intracellular loop. |
Rabbit Polyclonal Anti-M2 Muscarinic Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with a sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid.� residues 225-356 of human m2. 3rd intracellular loo |
Rabbit Polyclonal Anti-alpha1A-Adrenoceptor (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide EDETI*SQINEEPG(C), corresponding to amino acid residues 171-183 of human a1A adrenoceptor with replacement of cysteine 176 (C176) with serine. 2nd extracellular loop. |
Rabbit Polyclonal Anti-GABRD Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Polyclonal Anti-S1PR1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | S1PR1 / EDG1 / S1P1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human S1PR1 / EDG1. Percent identity with other species by BLAST analysis: Human, Platypus (100%); Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Panda, Horse, Opossum, Turkey, Lizard, Xenopus (94%); Shrew, Cat, Elephant, Pig (88%); Zebrafish (81%). |
Goat Polyclonal Antibody against CCKAR
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-FEASQKKSAKERKPST, from the internal region of the protein sequence according to NP_000721.1. |
Rabbit polyclonal anti-GRM1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRM1. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Marmoset, Mouse, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Rat, Rabbit (94%); Elephant (89%). |
GPR23 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | LPAR4 / GPR23 antibody was raised against synthetic 17 amino acid peptide from C-terminal cytoplasmic domain of human LPAR4 / GPR23. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Mouse, Rat, Bat, Hamster, Rabbit, Pig (94%); Monkey, Bovine, Panda, Horse (88%); Dog, Elephant (82%). |
AVPR1B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | AVPR1B antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human AVPR1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Mouse (94%). |
Histamine 3 Receptor / HRH3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HRH3 / Histamine 3 Receptor antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human HRH3 / Histamine H3 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Guinea pig (100%); Panda, Bat, Dog (94%); Opossum (81%). |
Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog |
| Conjugation | Unconjugated |
| Immunogen | ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Bovine, Dog (100%); Elephant (90%); Bat (85%); Opossum, Platypus (80%). |
MGLUR2 / GLUR2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRM2 / MGLUR2 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM2 / MGLUR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Pig (100%); Chimpanzee, Monkey, Horse, Platypus (95%). |
GRM7 / MGLUR7 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Elephant, Bovine (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Dog, Horse (95%); Gibbon, Panda, Rabbit, Opossum (89%); Chicken, Xenopus (84%). |
AGTR2 / AT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rat, Sheep, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | AGTR2 / AT2 Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human AGTR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Pig (100%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 14 amino acid peptide from 2nd extracellular domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Rabbit, Pig, Platypus (100%); Marmoset, Rat, Elephant, Panda, Dog, Bat, Horse (93%); Mouse, Hamster (86%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Rabbit, Pig (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat (87%). |
Rabbit Polyclonal Anti-APLNR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | APLNR/ Apelin Receptor / APJ antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human Apelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Horse (100%); Orangutan, Marmoset, Mouse, Rat, Bat, Rabbit (94%). |
Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey, Panda, Bat (100%); Gibbon, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Rabbit (95%); Horse (89%). |
Rabbit Polyclonal Anti-GHRHR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GHRHR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GHRHR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Zebu, Rabbit, Pig (94%); Panda, Bovine, Dog, Horse (88%). |
Rabbit Polyclonal Anti-GRM1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM1 / MGLUR1 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Elephant, Panda, Bovine, Rabbit (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Dog, Bat, Horse, Opossum (94%); Chicken, Platypus (88%); Xenopus (82%). |
Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR4 / 5-HT4 Receptor antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Bovine, Rabbit, Horse, Pig (100%); Mouse, Rat, Hamster (93%); Guinea pig, Platypus (87%); Lizard (80%). |
Rabbit Polyclonal Anti-MC3R Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MC3R / MC3 Receptor antibody was raised against synthetic 18 amino acid peptide from C-Terminus of human MC3 Receptor. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (94%); Bat, Rabbit, Platypus (89%); Opossum, Turkey, Chicken, Xenopus, Trout (83%). |
Rabbit Polyclonal Anti-GRM4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM4 / MGLUR4 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GRM4 / MGLUR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Rabbit, Pig (100%); Rat, Hamster, Dog (94%); Horse, Opossum (88%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-GPR50 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR50 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human GPR50. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Sheep, Dog (100%); Gibbon, Mouse, Rat, Panda, Bovine, Rabbit (94%); Bat (89%); Elephant (83%). |
Rabbit Polyclonal Anti-PTGFR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FP / PTGFR antibody was raised against synthetic 14 amino acid peptide from 1st cytoplasmic domain of human PTGFR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Elephant, Panda, Bat, Dog, Rabbit, Horse, Turkey, Chicken, Platypus (100%); Marmoset, Rat, Xenopus (93%); Sheep, Bovine, Pig (86%). |
PTGER3 (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified
| Applications | IHC |
| Reactivities | Human, Bovine, Pig, Horse, Monkey (Predicted: Rat, Bat, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from 1st cytoplasmic domain of human PTGER3 / EP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Bovine, Horse, Pig (100%); Gorilla, Rat, Elephant, Bat, Rabbit (94%); Mouse, Panda (88%). |
Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR4 / 5-HT4 Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat (94%); Marmoset, Hamster, Elephant, Panda, Dog, Horse, Pig, Guinea pig (88%); Bat, Rabbit (81%). |
Rabbit anti GluR6/7 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Germany
Japan
United Kingdom
China
