Rabbit Polyclonal Anti-AARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AARS antibody: synthetic peptide directed towards the C terminal of human AARS. Synthetic peptide located within the following region: VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT |
Rabbit Polyclonal Anti-SLA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLA antibody: synthetic peptide directed towards the N terminal of human SLA/LP. Synthetic peptide located within the following region: MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the C terminal of human CARS. Synthetic peptide located within the following region: KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD |
Rabbit Polyclonal Anti-CARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY |
Rabbit Polyclonal Anti-KARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV |
Rabbit polyclonal RARS Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RARS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 605-634 amino acids from the C-terminal region of human RARS. |
Rabbit Polyclonal Anti-TARS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TARS antibody: synthetic peptide directed towards the N terminal of human TARS. Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT |
Carrier-free (BSA/glycerol-free) HARS2 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Dog |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
Anti-AARS rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to N terminal 14 amino acids of human alanyl-tRNA synthetase |
Anti-AARS2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 686-985 amino acids of human alanyl-tRNA synthetase 2, mitochondrial |
Rabbit Polyclonal Anti-FARSB Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FARSB |
Rabbit Polyclonal Anti-KARS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KARS |
MTFMT mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MTFMT mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HARS2 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HARS2 mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HARS2 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HARS2 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HARS2 mouse monoclonal antibody, clone OTI6F9 (formerly 6F9)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GARS mouse monoclonal antibody, clone OTI4H8 (formerly 4H8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
