MSH2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MSH2 |
MSH2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MSH2 |
Rabbit Polyclonal Anti-MSH2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG |
Rabbit polyclonal anti-MSH2 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MSH2. |
Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody, clone OTI10F7
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal MSH2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Mismatch Repair Protein (MSH2) Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MSH2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MSH2 |
MSH2 mouse monoclonal antibody, clone OTI10F7
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSH2 mouse monoclonal antibody, clone OTI10F7
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSH2 mouse monoclonal antibody,clone UMAB259
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody,clone UMAB259
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MSH2 mouse monoclonal antibody,clone UMAB259
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |