Germany
Japan
United Kingdom
China
Antibodies
View as table Download
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Immunogen | WNT7A antibody was raised against synthetic 10 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Chicken, Platypus, Xenopus (80%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit polyclonal GSK3 Beta phospho S9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the aa 4-12 of human GSK3 beta. |
Rabbit Polyclonal Anti-BMP7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
Rabbit Polyclonal Anti-SHH Antibody
| Applications | IHC, WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Rabbit Polyclonal Anti-PTCH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM |
Rabbit Polyclonal Anti-ZIC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZIC2 antibody: synthetic peptide directed towards the C terminal of human ZIC2. Synthetic peptide located within the following region: EPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGSGSGGAGGGSGGGSGS |
Rabbit Polyclonal Anti-SMO Antibody (1st Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SMO / Smoothened antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human SMO. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus (94%); Opossum (88%). |
BMP8B rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
WNT4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT4 antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Pig (100%); Opossum (86%). |
WNT4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | WNT4 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant (94%); Opossum (88%). |
Anti-Human BMP-2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BMP-2 |
Anti-Human WNT-1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human WNT-1 |
Anti-Human WNT-3a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived recombinant Human WNT-3a. |
Mouse Monoclonal Wnt-5a Antibody (4M5E4)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | WNT1 antibody was raised against synthetic 19 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Chicken, Lizard (95%); Stickleback (84%). |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%). |
Rabbit Polyclonal Anti-WNT10B Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT10B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Elephant, Dog, Bat, Horse, Rabbit, Pig (100%); Hamster (94%); Panda (88%). |
Rabbit Polyclonal Anti-WNT10B Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | WNT10B antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT10B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Dog, Bat, Pig (100%); Marmoset, Elephant, Panda, Horse, Rabbit (93%). |
Rabbit Polyclonal Anti-SMO Antibody (N-Terminal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SMO / Smoothened antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human SMO. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Opossum (93%); Turkey, Chicken, Xenopus (87%); Zebrafish, Seq squirt (80%). |
Carrier-free (BSA/glycerol-free) GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-SMO Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor |
Anti-LRP2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 4640-4054 amino acids of Human low density lipoprotein receptor-related protein 2 |
Anti-LRP2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 4642-4654 amino acids of Human low density lipoprotein receptor-related protein 2 |
Active filters
Applications
- IHC
Families
- Druggable Genome
Pathways
- Hedgehog signaling pathway
Filter by
Category
Target Symbol
- GLI1 (40)
- WNT3 (22)
- CSNK1G1 (16)
- RAB23 (15)
- CSNK1E (12)
- GLI2 (11)
- GSK3B (9)
- PTCH1 (8)
- BMP4 (6)
- CSNK1G2 (6)
- SHH (6)
- WNT10B (6)
- WNT3A (6)
- SMO (5)
- WNT1 (5)
- CSNK1A1 (4)
- BMP2 (3)
- BMP7 (3)
- GLI3 (3)
- WNT5A (3)
- BMP5 (2)
- BMP6 (2)
- IHH (2)
- LRP2 (2)
- PRKACA (2)
- PRKACG (2)
- PRKX (2)
- STK36 (2)
- SUFU (2)
- WNT4 (2)
- WNT7A (2)
- BMP8B (1)
- BTRC (1)
- CSNK1A1L (1)
- CSNK1D (1)
- DHH (1)
- FBXW11 (1)
- PRKACB (1)
- ZIC2 (1)