Germany
Japan
United Kingdom
China
USD 379.00
In Stock
Antibodies
View as table Download
USD 379.00
In Stock
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Rabbit Polyclonal Anti-CBS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Rabbit Polyclonal Anti-ALAS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ |
Rabbit Polyclonal antibody to Glycine dehydrogenase (glycine dehydrogenase (decarboxylating))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 442 and 723 of Glycine dehydrogenase (Uniprot ID#P23378) |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
USD 480.00
2 Weeks
USD 480.00
2 Weeks
USD 480.00
2 Weeks
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
GLDC Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LENSGWITQYTPYQPEVSQGRLESLLNYQTMVCDITGLDMANASLLDEGT |
GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
In Stock
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
DLD (Lipoamide Dehydrogenase) mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Applications
- IHC
Families
- Druggable Genome
Pathways
- Glycine