Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit anti-HSPD1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPD1 |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly |
Conjugation | Unconjugated |
Non Neuronal Enolase (ENO1) (178-205) rabbit polyclonal antibody, Ig Fraction
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Hsp60 (HSPD1) goat polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
Immunogen | HSPD1 antibody was raised against recombinant human HSP60. |
Rabbit polyclonal anti-HSP60 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HSP60. |
USD 385.00
2 Weeks
Non Neuronal Enolase (ENO1) mouse monoclonal antibody, clone NSE-P1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733) |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Hsp60 (HSPD1) mouse monoclonal antibody, clone SJ-60, Purified
Applications | IHC, IP, WB |
Reactivities | Chicken, Human, Rat |
Hsp60 (HSPD1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide mapping at the middle region of human HSP60 |
Rabbit polyclonal HSPD1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
CNOT4 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Non Neuronal Enolase (ENO1) (N-term) rabbit polyclonal antibody, Ig Fraction
Applications | IHC, WB |
Reactivities | Human |
Immunogen | kLH conjugated synthetic peptide selected from the N-terminal region of Human ENO1. |
CNOT4 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CNOT4 antibody was raised against cNOT4 antibody was raised against a 19 amino acid peptide near the amino terminus of the human CNOT4. |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
Rabbit Polyclonal CNOT4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Xenopus |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody. |
Carrier-free (glycerol/BSA-free) CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI4E4
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody, clone OTI1B3 (formerly 1B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI3A2
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI3G1
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI6F7
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody,clone OTI6F11
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPD1 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Anti-HSPD1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human heat shock 60kDa protein 1 (chaperonin) |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENO1 |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody,clone 1H2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT4 mouse monoclonal antibody,clone 1H2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HSPD1 mouse monoclonal antibody,clone OTI4E4
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
HSPD1 mouse monoclonal antibody,clone 4E4, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
HSPD1 mouse monoclonal antibody,clone 4E4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
HSPD1 mouse monoclonal antibody,clone OTI4E4
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".