Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 203 results

Page 1 of 5

(reset)

Lipoamide Dehydrogenase (DLD) Rabbit Polyclonal Antibody

TA344335

USD 475.00

5 Days

Rabbit Polyclonal Anti-DLD Antibody - middle region

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ALDH2 Rabbit Polyclonal Antibody

TA327010

USD 275.00

3 Weeks

Rabbit anti-ALDH2 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ALDH2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ACAT1 Rabbit Polyclonal Antibody

TA332618

USD 275.00

3 Weeks

Rabbit anti-ACAT1 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ACAT1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PCCB Rabbit Polyclonal Antibody

TA308402

USD 415.00

2 Weeks

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

1 / 3

2 / 3

3 / 3

Previous Next

ERAB (HSD17B10) Rabbit Polyclonal Antibody

TA332692

USD 275.00

3 Weeks

Rabbit anti-HSD17B10 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HSD17B10

1 / 3

2 / 3

3 / 3

Previous Next

PDHA1 Rabbit Polyclonal Antibody

TA327210

USD 275.00

3 Weeks

Rabbit anti-PDHA1 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PDHA1

1 / 2

2 / 2

Previous Next

ALDH2 Rabbit Polyclonal Antibody

TA302016

USD 450.00

In Stock

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

1 / 2

2 / 2

Previous Next

PDHA1 Rabbit Polyclonal Antibody

TA311767

USD 345.00

In Stock

Rabbit polyclonal anti-PDHA1 antibody

Applications	IHC, WB
Reactivities	Human Mouse Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human PDHA1.

1 / 2

2 / 2

Previous Next

Aldehyde Oxidase (AOX1) Rabbit Polyclonal Antibody

TA313452

USD 345.00

In Stock

Rabbit polyclonal anti-AOX1 antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human AOX1.

1 / 2

2 / 2

Previous Next

ERAB (HSD17B10) Rabbit Polyclonal Antibody

TA326227

USD 345.00

In Stock

Rabbit polyclonal ERAB antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human ERAB.

1 / 3

2 / 3

3 / 3

Previous Next

ALDH6A1 Rabbit Polyclonal Antibody

TA302121

USD 450.00

5 Days

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

1 / 2

2 / 2

Previous Next

LARS2 Rabbit Polyclonal Antibody

TA308628

USD 415.00

5 Days

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 181 and 458 of LARS2 (Uniprot ID#Q15031)

1 / 3

2 / 3

3 / 3

Previous Next

ALDH6A1 Goat Polyclonal Antibody

TA311337

USD 375.00

5 Days

Goat Anti-ALDH6A1 (aa487-496) Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1.

1 / 2

2 / 2

Previous Next

ERAB (HSD17B10) Mouse Monoclonal Antibody [Clone ID: OTI10B4]

CF500686

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HSD17B10 mouse monoclonal antibody, clone OTI10B4 (formerly 10B4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ERAB (HSD17B10) Mouse Monoclonal Antibody [Clone ID: OTI11A2]

CF500724

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HSD17B10 mouse monoclonal antibody, clone OTI11A2 (formerly 11A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ERAB (HSD17B10) Mouse Monoclonal Antibody [Clone ID: OTI5E2]

CF500813

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HSD17B10 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF501217

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF501219

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501220

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI7B1]

CF501221

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF501222

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF501223

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF501224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF501225

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI1B7]

CF501238

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

IVD Mouse Monoclonal Antibody [Clone ID: OTI1B10]

CF501742

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IVD mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Mouse Monoclonal Antibody [Clone ID: OTI2A7]

CF503256

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH3A2 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications	FC, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI6D5]

CF503387

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI6D5 (formerly 6D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI4E11]

CF503390

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4E11 (formerly 4E11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI4A10]

CF503422

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Lipoamide Dehydrogenase (DLD) Mouse Monoclonal Antibody [Clone ID: OTI4D5]

CF503423

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DLD mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ACADS Mouse Monoclonal Antibody [Clone ID: OTI1D2]

CF800429

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADS mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI3D2]

CF806896

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H1]

CF806898

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6H1 (formerly 6H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI7C4]

CF806964

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7C4 (formerly 7C4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI1F10]

CF806966

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI3F6]

CF806967

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI6C9]

CF806968

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI6C9 (formerly 6C9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI7H1]

CF806969

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7H1 (formerly 7H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI4A10]

CF806970

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

ABAT Mouse Monoclonal Antibody [Clone ID: OTI7E9]

CF806972

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABAT mouse monoclonal antibody, clone OTI7E9 (formerly 7E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PCCA Mouse Monoclonal Antibody [Clone ID: OTI1E9]

CF811046

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1E9

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ALDH7A1 Mouse Monoclonal Antibody [Clone ID: OTI10A12]

CF811150

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI10A12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ALDH7A1 Mouse Monoclonal Antibody [Clone ID: OTI1A9]

CF811280

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH7A1 mouse monoclonal antibody,clone OTI1A9

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI2G7]

CF811761

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI2G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI10A5]

CF811764

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI10A5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI9G10]

CF811769

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI9G10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACADS Rabbit Polyclonal Antibody

TA321035

USD 345.00

In Stock

Anti-ACADS rabbit polyclonal antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain

ACADS Rabbit Polyclonal Antibody

TA321036

USD 345.00

4 Weeks

Anti-ACADS rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Aldehyde Oxidase (AOX1) Rabbit Polyclonal Antibody

TA321294

USD 345.00

In Stock

Anti-AOX1 rabbit polyclonal antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1

1 - 50 of 203 results

Page 1 of 5