Antibodies

Jump to Filters
View as table Download
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA345667

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA349205

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA326807

USD 275.00

3 Weeks

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA308840

USD 415.00

In Stock

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin
beta Actin (ACTB) Rabbit Polyclonal Antibody
TA313195

USD 345.00

4 Weeks

Rabbit polyclonal anti-Actin-pan antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Actin.
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA308938

USD 415.00

5 Days

Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252)
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA321516

USD 345.00

In Stock

Anti-PRKCA rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA321517

USD 345.00

In Stock

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha
PKC alpha (PRKCA) Rabbit Polyclonal Antibody
TA350903

USD 345.00

In Stock

Rabbit Polyclonal Anti-PRKCA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKCA