Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 585.00
3 Weeks
Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus. |
Rabbit polyclonal GABRA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal 5-HT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563. |
USD 375.00
5 Days
USD 410.00
5 Days
Rabbit Polyclonal Anti-GABRD Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
Anti-GABRR1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of Human gamma-aminobutyric acid (GABA) A receptor, rho 1 |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CHRNA1 |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
GABRA5 mouse monoclonal antibody, clone OTI3H7 (formerly 3H7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Reactivities
- Rat
Applications
- IHC
Families
- Ion Channels: Cys-loop Receptors