Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 26 of 26 results

(reset)

PPAR gamma (PPARG) Rabbit Polyclonal Antibody

TA326810

USD 275.00

3 Weeks

PPARG Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	N term -peptide of human PPARG

1 / 2

2 / 2

Previous Next

Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody

TA312331

USD 345.00

In Stock

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR delta (PPARD) Rabbit Polyclonal Antibody

TA332820

USD 275.00

3 Weeks

Rabbit anti-PPARD Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PPARD

LXR alpha (NR1H3) Rabbit Polyclonal Antibody

TA306911

USD 430.00

5 Days

Rabbit Polyclonal LXR-A Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A.

1 / 3

2 / 3

3 / 3

Previous Next

PPAR gamma (PPARG) Rabbit Polyclonal Antibody

TA336911

USD 424.00

5 Days

Rabbit Polyclonal PPAR gamma/NR1C3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human PPAR gamma protein (between residues 20-120) [UniProt P37231]

1 / 2

2 / 2

Previous Next

PPAR delta (PPARD) Rabbit Polyclonal Antibody

TA343593

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS

1 / 2

2 / 2

Previous Next

PPAR delta (PPARD) Rabbit Polyclonal Antibody

TA343594

USD 310.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

1 / 2

2 / 2

Previous Next

PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]

CF503545

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

CF805015

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI4D10]

CF811238

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI4D10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR alpha (PPARA) Rabbit Polyclonal Antibody

TA321679

USD 345.00

In Stock

Anti-PPARA rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha

PPAR gamma (PPARG) Rabbit Polyclonal Antibody

TA321842

USD 345.00

4 Weeks

Anti-PPARG Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma

PPAR gamma (PPARG) Rabbit Polyclonal Antibody

TA321843

USD 345.00

In Stock

Anti-PPARG Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR delta (PPARD) Rabbit Polyclonal Antibody

TA322524

USD 345.00

In Stock

Anti-PPARD Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 1-14 amino acids of human peroxisome proliferator-activated receptor delta

PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]

TA503545

USD 379.00

In Stock

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR alpha (PPARA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G6]

TA503545AM

USD 420.00

4 Weeks

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR alpha (PPARA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G6]

TA503545BM

USD 420.00

4 Weeks

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR alpha (PPARA) Mouse Monoclonal Antibody [Clone ID: OTI2G6]

TA503545S

USD 159.00

2 Days

PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

TA805015

USD 379.00

In Stock

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

LXR alpha (NR1H3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

TA805015AM

USD 420.00

4 Weeks

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

LXR alpha (NR1H3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A5]

TA805015BM

USD 420.00

4 Weeks

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

LXR alpha (NR1H3) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

TA805015S

USD 159.00

2 Days

NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI4D10]

TA811238

USD 379.00

In Stock

PPARD mouse monoclonal antibody,clone OTI4D10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR delta (PPARD) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D10]

TA811238AM

USD 420.00

4 Weeks

PPARD mouse monoclonal antibody,clone OTI4D10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR delta (PPARD) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D10]

TA811238BM

USD 420.00

4 Weeks

PPARD mouse monoclonal antibody,clone OTI4D10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI4D10]

TA811238S

USD 159.00

In Stock

PPARD mouse monoclonal antibody,clone OTI4D10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 26 of 26 results