Antibodies

Jump to Filters
View as table Download
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346200

USD 475.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
Trypsin (PRSS3) (Center) Rabbit Polyclonal Antibody
AP53469PU-N

USD 450.00

2 Weeks

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3
Trypsin (PRSS3) (N-term) Rabbit Polyclonal Antibody
AP53470PU-N

USD 450.00

2 Weeks

Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3
Plasminogen (PLG) Rabbit Polyclonal Antibody
TA324919

USD 450.00

5 Days

Rabbit polyclonal PLG Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG.
Cathepsin G (CTSG) Rabbit Polyclonal Antibody
AP20583PU-N

USD 370.00

2 Weeks

Cathepsin G (CTSG) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 71-120 of Human Cathepsin G.
Plasminogen (PLG) Mouse Monoclonal Antibody [Clone ID: OTI4F5]
CF810638

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PLG mouse monoclonal antibody,clone OTI4F5

Applications IHC
Reactivities Human
Conjugation Unconjugated
Plasminogen (PLG) Rabbit Polyclonal Antibody
TA351544

USD 345.00

In Stock

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG
Prothrombin (F2) Rabbit Polyclonal Antibody
TA351802

USD 345.00

In Stock

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2
Plasminogen (PLG) Mouse Monoclonal Antibody [Clone ID: OTI4F5]
TA810638S

USD 159.00

2 Days

PLG mouse monoclonal antibody,clone OTI4F5

Applications IHC
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".