Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 10 of 10 results

(reset)

JAB1 (COPS5) (full length) Mouse Monoclonal Antibody [Clone ID: 8H8.5]

AM20857PU-N

USD 440.00

2 Weeks

JAB1 (COPS5) (full length) mouse monoclonal antibody, clone 8H8.5, Purified

Applications	IHC, IP, WB
Reactivities	Human, Mouse

1 / 2

2 / 2

Previous Next

JAB1 (COPS5) Rabbit Polyclonal Antibody

AP20452PU-N

USD 407.00

2 Weeks

JAB1 (COPS5) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

JAB1 (COPS5) (N-term) Rabbit Polyclonal Antibody

AP31028PU-N

USD 440.00

2 Weeks

JAB1 (COPS5) (N-term) rabbit polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	A synthetic peptide from N-terminal of human JAB1 protein

JAB1 (COPS5) Rabbit Polyclonal Antibody

TA331188

USD 375.00

5 Days

Rabbit Polyclonal Anti-COPS5 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: NMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVM

1 / 2

2 / 2

Previous Next

JAB1 (COPS5) Mouse Monoclonal Antibody [Clone ID: OTI2B12]

CF504344

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) COPS5 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

JAB1 (COPS5) Rabbit Polyclonal Antibody

TA322462

USD 345.00

In Stock

Anti-COPS5 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

JAB1 (COPS5) Mouse Monoclonal Antibody [Clone ID: OTI2B12]

TA504344

USD 379.00

In Stock

COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

JAB1 (COPS5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B12]

TA504344AM

USD 420.00

4 Weeks

COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

JAB1 (COPS5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B12]

TA504344BM

USD 420.00

4 Weeks

COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

JAB1 (COPS5) Mouse Monoclonal Antibody [Clone ID: OTI2B12]

TA504344S

USD 159.00

2 Days

COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 10 of 10 results