Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-MRE11A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MRE11A |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Rabbit Polyclonal MRE11 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11. |
Rabbit polyclonal Bloom Syndrome Protein (Thr99)(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bloom Syndrome Protein around the phosphorylation site of threonine 99 (Q-E-TP-Q-R). |
Modifications | Phospho-specific |
RAD51 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
RAD54 (RAD54L) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 641-671 amino acids from the C-terminal region of Human RAD54 |
Rabbit Polyclonal Antibody against Mre11
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
RAD51 mouse monoclonal antibody, clone 13E4, Purified
Applications | IHC, WB |
Reactivities | Human |
MRE11 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAD51 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
RAD51 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human RAD51A |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-RAD51 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 301-312 amino acids of Human RAD51 homolog (S. cerevisiae) |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MRE11A |
Rabbit Polyclonal Anti-RPA2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MRE11A |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RAD51 |
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1), Biotinylated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1), HRP conjugated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |