EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCND1 |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
Modifications | Phospho-specific |
Rabbit anti-PIAS2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PIAS2 |
Rabbit polyclonal STAT5B (Ser731) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731 (A-P-SP-P-A). |
Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal STAT5B (Ab-731) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731(A-P-S-P-A). |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3. |
Modifications | Phospho-specific |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
Rabbit Polyclonal c-Myc Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106] |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Smad3 (Ab-204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal anti-EGFR antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Rabbit Polyclonal PIAS2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2. |
Rabbit polyclonal EGFR Antibody (S1070)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR. |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Rabbit Polyclonal Antibody against MYC (T58)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC. |
Goat Anti-PIAS2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P). |
Modifications | Phospho-specific |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-SMAD3 antibody
Applications | IHC, WB |
Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Anti-SMAD2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2. |
Anti-SMAD3 Rabbit Polyclonal Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3. |
Rabbit polyclonal STAT5b Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This STAT5b antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 760-787 amino acids from the C-terminal region of human STAT5b. |
Rabbit Polyclonal Smad2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Primate |
Conjugation | Unconjugated |
Immunogen | Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen. |
Rabbit Polyclonal Anti-Pias2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
Rabbit anti STAT5 (pY694) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- with phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti STAT5 (Paired Y694) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- without phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Stat5a mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STAT5A mouse monoclonal antibody, clone OTI9F7 (formerly 9F7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STAT5A mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STAT5A mouse monoclonal antibody, clone OTI6D6 (formerly 6D6)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STAT5A mouse monoclonal antibody, clone OTI11A9 (formerly 11A9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STAT5A mouse monoclonal antibody, clone OTI9A5 (formerly 9A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI6E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI3F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-CCND1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Anti-STAT5B Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B |
Anti-STAT5B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B |
Rabbit Polyclonal Anti-PIAS2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIAS2 |