Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
| Modifications | Phospho-specific |
Rabbit anti-PIAS2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PIAS2 |
Rabbit polyclonal STAT5B (Ser731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731 (A-P-SP-P-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT1 (Tyr701) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT1 (Ser727) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT1 around the phosphorylation site of serine 727 (P-M-SP-P-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT5B (Ab-731) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731(A-P-S-P-A). |
Rabbit polyclonal STAT3 (Phospho-Tyr705) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal STAT1 alpha Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STAT1 alpha antibody was raised against a peptide corresponding to 38 amino acids near the carboxy terminus of human STAT1 alpha. The sequences differ from the murine corresponding sequences by four amino acids. The immunogen is located within the last 50 amino acids of STAT1 alpha. |
Rabbit polyclonal STAT2 phospho Y690 antibody
| Applications | IHC, WB |
| Reactivities | Human, Chimpanzee, Macaque, Vervet Monkey, Rat, Dog, Pig, Horse, Mouse, Bovine |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein. |
Anti-STAT3 (Phospho-Ser727) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 727 (P-M-S(p)-P-R) derived from Human STAT3. |
| Modifications | Phospho-specific |
Anti-STAT4 (Phospho-Tyr693) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 693 (K-G-Y(p)-V-P) derived from Human STAT4. |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-STAT3(S727) Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3. |
| Modifications | Phospho-specific |
Goat Anti-PIAS2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit anti-STAT4 (Phospho-Tyr693) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT4 around the phosphorylation site of tyrosine 693 (K-G-YP-V-P). |
| Modifications | Phospho-specific |
Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT2 (Tyr690) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT2 around the phosphorylation site of tyrosine 690 (R-K-YP-L-K) |
| Modifications | Phospho-specific |
Anti-STAT1 (Phospho-Tyr701) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 701 (T-G-Y(p)-I-K) derived from Human STAT1. |
| Modifications | Phospho-specific |
Rabbit polyclonal STAT5b Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This STAT5b antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 760-787 amino acids from the C-terminal region of human STAT5b. |
Rabbit Polyclonal STAT1(Ser727) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human STAT1 around the phosphorylation site of Sersine 727. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Pias2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE |
Rabbit anti STAT5 (pY694) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- with phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti STAT5 (Paired Y694) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- without phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti-STAT1 (Phospho-Ser727) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of serine 727 (P-M-SP-P-E). |
| Modifications | Phospho-specific |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
