Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit anti-ENO1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ENO1 |
Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733) |
Rabbit polyclonal CAF-1 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1. |
Rabbit polyclonal CNOT8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8. |
Rabbit polyclonal ENO1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
Rabbit Polyclonal CNOT4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Xenopus |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody. |
Carrier-free (glycerol/BSA-free) CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI4C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARN mouse monoclonal antibody,clone OTI2D9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ENO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENO1 |
Rabbit Polyclonal Anti-DCP1A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DCP1A |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT4 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNOT4 mouse monoclonal antibody,clone 1H2, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNOT4 mouse monoclonal antibody,clone 1H2, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNOT4 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARN mouse monoclonal antibody,clone OTI1G5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 1G5, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 1G5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARN mouse monoclonal antibody,clone OTI1G5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARN mouse monoclonal antibody,clone OTI4E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 4E12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 4E12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARN mouse monoclonal antibody,clone OTI4E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARN mouse monoclonal antibody,clone OTI4C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 4C9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 4C9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARN mouse monoclonal antibody,clone OTI4C9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARN mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 4D12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 4D12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARN mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARN mouse monoclonal antibody,clone OTI1G7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PARN mouse monoclonal antibody,clone 1G7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARN mouse monoclonal antibody,clone 1G7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |