Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CYP2D6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6. Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
UGT1A9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A9 |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
CYP2A13 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 306-360 of Human CYP2A13. |
USD 370.00
2 Weeks
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224) |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 1A2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal anti-MGST3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST3. |
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit polyclonal CYP2E1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
USD 440.00
2 Weeks
Rabbit polyclonal CYP2D6 Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2D6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 76-105 amino acids from the N-terminal region of human CYP2D6. |
Rabbit polyclonal Anti-UGT1A7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
USD 1,140.00
9 Weeks
USD 1,140.00
9 Weeks
USD 1,140.00
9 Weeks
USD 1,140.00
9 Weeks
USD 1,140.00
2 Weeks
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
4 Weeks
Anti-CYP3A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Active filters
Applications
- IHC
Families
- Transmembrane
Pathways
- Drug metabolism - cytochrome P450