Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 42 of 42 results

(reset)

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

TA327035

USD 275.00

3 Weeks

Rabbit anti-HMOX1 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HMOX1

1 / 2

2 / 2

Previous Next

UGT (UGT1A9) Rabbit Polyclonal Antibody

TA308133

USD 415.00

In Stock

Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656)

1 / 3

2 / 3

3 / 3

Previous Next

UGT (UGT1A9) Rabbit Polyclonal Antibody

TA327128

USD 275.00

3 Weeks

UGT1A9 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human UGT1A9

beta glucuronidase (GUSB) (Center) Rabbit Polyclonal Antibody

AP51986PU-N

USD 450.00

2 Weeks

beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human, Porcine
Immunogen	KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase

1 / 3

2 / 3

3 / 3

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

AP21303PU-N

USD 440.00

2 Weeks

Heme Oxygenase 1 (HMOX1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, IP, WB
Reactivities	Canine, Hamster, Human, Monkey, Mouse, Rabbit, Rat
Immunogen	Synthetic peptide derived from sequence near the amino terminus of Human HO-1 (Hsp32)

1 / 2

2 / 2

Previous Next

COX10 (C-term) Rabbit Polyclonal Antibody

AP51029PU-N

USD 450.00

2 Weeks

COX10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 386-414 amino acids from the C-terminal region of human COX1

1 / 3

2 / 3

3 / 3

Previous Next

UGT2B15 (Center) Rabbit Polyclonal Antibody

AP54455PU-N

USD 450.00

2 Weeks

UGT2B15 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 163-193 amino acids from the Central region of human UGT2B15

1 / 3

2 / 3

3 / 3

Previous Next

UGT1A6 Rabbit Polyclonal Antibody

TA309014

USD 415.00

5 Days

Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224)

1 / 3

2 / 3

3 / 3

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

AP22888PU-N

USD 523.00

5 Days

Heme Oxygenase 1 rabbit polyclonal antibody, Protein A purified

Applications	IHC, WB
Reactivities	Rat, Human, Mouse
Conjugation	Unconjugated
Immunogen	Native rat liver HO-1 (Hsp32) protein.

1 / 3

2 / 3

3 / 3

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

AP22896PU-N

USD 440.00

2 Weeks

Heme Oxygenase 1 (HMOX1) rabbit polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Canine, Human, Mouse, Rat
Immunogen	Recombinant Rat HO-1 (Hsp32) lacking the membrane spanning region

1 / 2

2 / 2

Previous Next

beta glucuronidase (GUSB) (C-term) Rabbit Polyclonal Antibody

AP51987PU-N

USD 450.00

2 Weeks

beta glucuronidase (GUSB) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 514-544 amino acids from the C-terminal region of Human Beta-glucuronidase

1 / 2

2 / 2

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

BP545

USD 610.00

5 Days

Heme Oxygenase 1 (HMOX1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Porcine, Rat
Immunogen	Synthetic peptide corresponding to aa residues 12-25 + Cys-NH2 of the Human HO-1 protein

Heme oxygenase 2 (HMOX2) Goat Polyclonal Antibody

TA305779

USD 375.00

5 Days

Goat Anti-HMOX2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-DQAGSTLARETLED, from the internal region of the protein sequence according to NP_002125.3.

1 / 2

2 / 2

Previous Next

UGT1A7 Rabbit Polyclonal Antibody

TA331082

USD 375.00

5 Days

Rabbit polyclonal Anti-UGT1A7 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

1 / 2

2 / 2

Previous Next

beta glucuronidase (GUSB) Rabbit Polyclonal Antibody

TA334656

USD 310.00

5 Days

Rabbit Polyclonal Anti-GUSB Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

1 / 3

2 / 3

3 / 3

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

TA336832

USD 424.00

5 Days

Rabbit Polyclonal HO-1/HMOX1/HSP32 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human Heme Oxygenase 1 protein (between residues 100-150) [UniProt P09601]

1 / 2

2 / 2

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

TA336833

USD 424.00

5 Days

Rabbit Polyclonal HO-1/HMOX1/HSP32 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to a C-terminal portion of the human Heme Oxygenase 1 protein (between residues 225-275) [UniProt P09601]

1 / 2

2 / 2

Previous Next

COX15 Rabbit Polyclonal Antibody

TA339409

USD 310.00

5 Days

Rabbit Polyclonal Anti-COX15 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

1 / 3

2 / 3

3 / 3

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1C2]

CF503813

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HMOX2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

CF503819

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) HMOX2 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

CF503822

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HMOX2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1H10]

CF503823

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HMOX2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme Oxygenase 1 (HMOX1) Rabbit Polyclonal Antibody

TA321437

USD 345.00

In Stock

Anti-HMOX1 Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Full length fusion protein

COX10 Rabbit Polyclonal Antibody

TA323193

USD 345.00

In Stock

Anti-COX10 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to N terminal 300 amino acids of Human COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase

UGT (UGT2B4) Rabbit Polyclonal Antibody

TA350581

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human UGT2B4

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

UGT1A6 Rabbit Polyclonal Antibody

TA351893

USD 345.00

In Stock

Rabbit Polyclonal Anti-UGT1A6 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human UGT1A6

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1C2]

TA503813

USD 379.00

In Stock

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C2]

TA503813AM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C2]

TA503813BM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1C2]

TA503813S

USD 159.00

2 Days

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

TA503819

USD 379.00

In Stock

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D10]

TA503819AM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D10]

TA503819BM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

TA503819S

USD 159.00

2 Days

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

TA503822

USD 379.00

In Stock

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]

TA503822AM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]

TA503822BM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

TA503822S

USD 159.00

2 Days

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1H10]

TA503823

USD 379.00

In Stock

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]

TA503823AM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H10]

TA503823BM

USD 420.00

4 Weeks

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Heme oxygenase 2 (HMOX2) Mouse Monoclonal Antibody [Clone ID: OTI1H10]

TA503823S

USD 159.00

2 Days

HMOX2 (Heme oxygenase 2) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 42 of 42 results