Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal antibody to H-Ras (v-Ha-ras Harvey rat sarcoma viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 111 and 189 of H-Ras (Uniprot ID#P01112) |
Rabbit polyclonal anti-NCK2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NCK2. |
Rabbit polyclonal EPHA3/4/5 (Tyr779/833) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPHA3/4/5 around the phosphorylation site of tyrosine 779 (A-A-YP-T-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal Ephrin B1/B2 (Tyr329) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2 around the phosphorylation site of tyrosine 329 (P-V-YP-I-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK2 (Ser197) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK2 around the phosphorylation site of serine 197 (T-R-SP-V-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK3 (Ser154) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK3 around the phosphorylation site of serine 154 (Y-M-SP-F-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ROBO2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ROBO2. |
Rabbit polyclonal anti-ROBO-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat and Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1632-1644 of Human ROBO-1. |
Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2. |
| Modifications | Phospho-specific |
Anti-PAK1 (Phospho-Thr212) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 212 (P-V-T(p)-P-T) derived from Human PAK1. |
| Modifications | Phospho-specific |
Rabbit polyclonal Bi-Phospho-GSK3B(S21/29) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GSK3B Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S21/29 of human GSK3B. |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit polyclonal FYN Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FYN. |
Rabbit polyclonal NRAS Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-179 amino acids from the C-terminal region of human NRAS. |
Rabbit polyclonal Fyn (Phospho-Tyr530) antibody
| Applications | IHC, WB |
| Reactivities | Human: Tyr530, Mouse: Tyr527 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Fyn around the phosphorylation site of tyrosine 530 (P-Q-YP-Q-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal PAK1/2/3 (Phospho-Thr423/402/421) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1/2/3 around the phosphorylation site of threonine 423/402/421 (R-S-TP-M-V). |
| Modifications | Phospho-specific |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A purified peptide conjugated to KLH |
USD 440.00
2 Weeks
PAK5 (Internal) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Synthetic 18 amino acid peptide from internal region of human PAK7 |
ROCK2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human ROCK2 |
CXCR4 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human CXCR4 |
Rabbit anti-LIMK1 (Phospho-Thr508) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanLIMK1 around the phosphorylation site of threonine 508 (R-Y-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit anti-LIMK2 (Phospho-Thr505) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanLIMK2 around the phosphorylation site of threonine 505 (R-Y-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal CRMP-2 (Thr509) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CRMP-2 around the phosphorylation site of threonine 509 (S-V-TP-PK). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Cdk5 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | cdk5 (p31) peptide corresponding to the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal GSK3 Beta phospho S9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the aa 4-12 of human GSK3 beta. |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
Rabbit Polyclonal Anti-NFATC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the middle region of human NFATC4. Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV |
Active filters
Applications
- IHC
Isotypes
- IgG
Pathways
- Axon guidance
Filter by
Category
Target Symbol
- PAK1 (8)
- CXCR4 (7)
- CXCL12 (6)
- DPYSL2 (6)
- GSK3B (6)
- LIMK2 (6)
- ROCK2 (6)
- CDK5 (4)
- CFL1 (4)
- MAPK1 (4)
- PAK2 (4)
- ABL1 (3)
- EFNA1 (3)
- EFNA5 (3)
- EPHB6 (3)
- FYN (3)
- LIMK1 (3)
- MET (3)
- NFATC4 (3)
- NRAS (3)
- PAK5 (3)
- PPP3CA (3)
- ROCK1 (3)
- SEMA4B (3)
- ABLIM1 (2)
- CHP1 (2)
- EFNA3 (2)
- EFNB1 (2)
- EFNB2 (2)
- EFNB3 (2)
- EPHA6 (2)
- HRAS (2)
- ITGB1 (2)
- MAPK3 (2)
- NCK1 (2)
- NCK2 (2)
- NFATC1 (2)
- NFATC2 (2)
- NFATC3 (2)
- PAK3 (2)
- PAK4 (2)
- PTK2 (2)
- ROBO2 (2)
- SEMA3D (2)
- SEMA6A (2)
- SLIT1 (2)
- ARHGEF12 (1)
- CDC42 (1)
- CFL2 (1)
- DCC (1)
- DPYSL5 (1)
- EFNA4 (1)
- EPHA1 (1)
- EPHA2 (1)
- EPHA3 (1)
- EPHA4 (1)
- EPHA7 (1)
- EPHB1 (1)
- EPHB3 (1)
- FES (1)
- GNAI1 (1)
- GNAI3 (1)
- L1CAM (1)
- NFAT5 (1)
- NRP1 (1)
- PAK6 (1)
- PAK7 (1)
- PLXNA1 (1)
- PLXNA2 (1)
- PLXNA3 (1)
- PLXNB1 (1)
- PLXNB2 (1)
- PPP3CB (1)
- RAC1 (1)
- RAC2 (1)
- ROBO1 (1)
- ROBO3 (1)
- SEMA3E (1)
- SEMA3F (1)
- SEMA3G (1)
- SEMA4A (1)
- SEMA4C (1)
- SEMA4F (1)
- SEMA6D (1)
- SEMA7A (1)
- SLIT2 (1)
- SLIT3 (1)
- SRGAP1 (1)
- SRGAP2 (1)
- SRGAP3 (1)