Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal Antibody against DDX3X (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DDX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 456-485 amino acids from the C-terminal region of human DDX3. |
Rabbit Polyclonal Antibody against UBE2S (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 192-222 amino acids from the C-terminal region of human E2EPF. |
Rabbit Polyclonal Antibody against UBE2S (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human E2EPF. |
Rabbit Polyclonal antibody to LIMCH1 (LIM and calponin homology domains 1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 734 and 1007 of LIMCH1 (Uniprot ID#Q9UPQ0) |
Rabbit Polyclonal antibody to TCP1 theta (chaperonin containing TCP1, subunit 8 (theta))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 111 and 367 of TCP1 theta (Uniprot ID#P50990) |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 280 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Guinea Pig, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%). |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 17 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Pufferfish, Zebrafish (100%); Salmon, Stickleback (94%); Opossum, Seq squirt (82%). |
TMEM33 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | TMEM33 antibody was raised against synthetic 18 amino acid peptide from internal region of human TMEM33. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Elephant, Panda, Horse, Pig, Opossum, Platypus (100%); Mouse, Rat, Hamster, Rabbit, Turkey, Chicken, Lizard, Xenopus, Zebrafish (94%); Catfish, Salmon, Stickleback, Sea anemone (89%); Drosophila (83%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal anti-Pdcd4 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding amino acids near the carboxyl terminus of human Pdcd4 protein. |
Rabbit polyclonal Pdcd4 phospho S457 antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Ser457 in the human Pdcd4 protein. |
| Modifications | Phospho-specific |
Rabbit polyclonal CKII alpha (CSNK2A1) Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CKII alpha (CSNK2A1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 240-269 amino acids from the Central region of human CKII alpha (CSNK2A1). |
Rabbit Polyclonal Anti-GRM5 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM5 / MGLUR5 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM5 / MGLUR5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Horse, Rabbit, Pig, Turkey, Zebra finch, Chicken, Platypus, Lizard (100%); Xenopus (94%); Opossum, Pufferfish (88%); Zebrafish (82%). |
Rabbit Polyclonal Anti-S1PR1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | S1PR1 / EDG1 / S1P1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human S1PR1 / EDG1. Percent identity with other species by BLAST analysis: Human, Platypus (100%); Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Panda, Horse, Opossum, Turkey, Lizard, Xenopus (94%); Shrew, Cat, Elephant, Pig (88%); Zebrafish (81%). |
Rabbit Polyclonal Anti-Egr1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
Rabbit Polyclonal Anti-EGR1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of mouse EGR1. Synthetic peptide located within the following region: GTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESF |
USD 1,140.00
9 Weeks
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Guinea pig, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%). |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KIAA0152 / MLEC Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KIAA0152 / MLEC antibody was raised against synthetic 18 amino acid peptide from internal region of human MLEC. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (94%). |
SURF4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Xenopus, Gorilla, Human, Mouse, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | SURF4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Turkey, Chicken, Xenopus, Salmon (100%); Marmoset, Hamster, Elephant, Panda, Dog, Bat, Opossum, Platypus, Pufferfish, Zebrafish (94%); Stickleback (89%). |
TNIK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TNIK antibody was raised against synthetic 18 amino acid peptide from internal region of human TNIK. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Lizard (100%); Xenopus (94%). |
Rabbit polyclonal SOD (Mn) Antibody
| Applications | IHC |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Gerbil, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig |
| Conjugation | Unconjugated |
| Immunogen | Human Mn SOD |
Mouse Monoclonal Anti-Kv1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HUNK Antibody (Kinase Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HUNK / B19 antibody was raised against synthetic 18 amino acid peptide from Protein kinase domain of human HUNK. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Turkey, Chicken, Lizard (100%); Opossum, Xenopus (94%); Pufferfish (83%). |
Active filters
Reactivities
- Xenopus
Applications
- IHC
Filter by
Category
Target Symbol
- PDCD4 (3)
- EGR1 (2)
- ESRRG (2)
- GAPDH (2)
- GLG1 (2)
- H2AFZ (2)
- HPRT1 (2)
- KCNMA1 (2)
- SMAD3 (2)
- TM9SF3 (2)
- UBE2S (2)
- ABCA4 (1)
- ACTA1 (1)
- ACTC1 (1)
- ACTG1 (1)
- ADAMTS1 (1)
- ADGRA2 (1)
- ADGRL4 (1)
- ARF3 (1)
- ATG5 (1)
- ATP1A1 (1)
- BHMT (1)
- BICC1 (1)
- C9ORF78 (1)
- CALCRL (1)
- CANX (1)
- CASK (1)
- CASR (1)
- CCT8 (1)
- CDK1 (1)
- CKB (1)
- CLTC (1)
- CNOT4 (1)
- CNOT7 (1)
- CPNE3 (1)
- CS (1)
- CSNK2A1 (1)
- CTNNB1 (1)
- CYP4A11 (1)
- DDX39A (1)
- DDX3X (1)
- DLG4 (1)
- DLST (1)
- DTX1 (1)
- ENO1 (1)
- EPS8 (1)
- FBXO43 (1)
- GID8 (1)
- GIPC1 (1)
- GJA1 (1)
- GLDC (1)
- GLI3 (1)
- GLO1 (1)
- GPR19 (1)
- GPRC5B (1)
- GRB2 (1)
- GRM5 (1)
- HIF1A (1)
- HRAS (1)
- HSPA8 (1)
- HSPD1 (1)
- HSPE1 (1)
- HTR1F (1)
- HUNK (1)
- IDI1 (1)
- IPO7 (1)
- IRX3 (1)
- ITPA (1)
- KCNA2 (1)
- KCND3 (1)
- KPNA4 (1)
- KRR1 (1)
- LIMCH1 (1)
- MAP1B (1)
- MAP2K4 (1)
- MAPK1 (1)
- MIB1 (1)
- MLEC (1)
- MMP2 (1)
- MYC (1)
- NCS1 (1)
- NDUFAB1 (1)
- NEK7 (1)
- NPR3 (1)
- NR2F1 (1)
- OGT (1)
- OSGEP (1)
- PCCB (1)
- PGD (1)
- PIK3C3 (1)
- PIK3R1 (1)
- PPP1CC (1)
- PPP3CB (1)
- PRPS2 (1)
- PSMB8 (1)
- PTGES (1)
- PTGFR (1)
- RAB6A (1)
- RAC1 (1)
- RBPJ (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (100)
- Transmembrane (36)
- Transcription Factors (18)
- Protein Kinase (13)
- ES Cell Differentiation/IPS (11)
- GPCR (10)
- Stem cell - Pluripotency (10)
- Secreted Protein (6)
- Cancer stem cells (5)
- Embryonic stem cells (5)
- Protease (4)
- Ion Channels: Potassium (3)
- Nuclear Hormone Receptor (3)
- Stem cell relevant signaling - JAK/STAT signaling pathway (3)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (3)
- Adult stem cells (2)
- Induced pluripotent stem cells (2)
- Ion Channels: Other (2)
- Phosphatase (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Ion Channels: Transient receptor potential (1)
- P450 (1)
Pathways
- Metabolic pathways (22)
- Pathways in cancer (15)
- Wnt signaling pathway (11)
- MAPK signaling pathway (10)
- Gap junction (9)
- Colorectal cancer (8)
- Focal adhesion (8)
- Adherens junction (7)
- Chronic myeloid leukemia (7)
- B cell receptor signaling pathway (6)
- Endometrial cancer (6)
- ErbB signaling pathway (6)
- Fc epsilon RI signaling pathway (6)
- Huntington's disease (6)
- Melanogenesis (6)
- Natural killer cell mediated cytotoxicity (6)
- Neuroactive ligand-receptor interaction (6)
- Regulation of actin cytoskeleton (6)
- Renal cell carcinoma (6)
- Vascular smooth muscle contraction (6)
- Acute myeloid leukemia (5)
- Alzheimer's disease (5)
- Basal cell carcinoma (5)
- Chemokine signaling pathway (5)
- GnRH signaling pathway (5)
- Insulin signaling pathway (5)
- Leukocyte transendothelial migration (5)
- Long-term potentiation (5)
- Neurotrophin signaling pathway (5)
- Oocyte meiosis (5)
- Pancreatic cancer (5)
- Pathogenic Escherichia coli infection (5)
- Prostate cancer (5)
- T cell receptor signaling pathway (5)
- VEGF signaling pathway (5)
- Axon guidance (4)
- Bladder cancer (4)
- Cell cycle (4)
- Endocytosis (4)
- Glioma (4)
- Hedgehog signaling pathway (4)
- Jak-STAT signaling pathway (4)
- Non-small cell lung cancer (4)
- Purine metabolism (4)
- RNA degradation (4)
- TGF-beta signaling pathway (4)
- Thyroid cancer (4)
- Tight junction (4)
- Toll-like receptor signaling pathway (4)
- mTOR signaling pathway (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Calcium signaling pathway (3)
- Citrate cycle (TCA cycle) (3)
- Drug metabolism - other enzymes (3)
- Fc gamma R-mediated phagocytosis (3)
- Glycolysis / Gluconeogenesis (3)
- Long-term depression (3)
- Melanoma (3)
- Parkinson's disease (3)
- Progesterone-mediated oocyte maturation (3)
- Ubiquitin mediated proteolysis (3)
- Amyotrophic lateral sclerosis (ALS) (2)
- Antigen processing and presentation (2)
- Apoptosis (2)
- Arachidonic acid metabolism (2)
- Cardiac muscle contraction (2)
- Cell adhesion molecules (CAMs) (2)
- Dilated cardiomyopathy (2)
- Dorso-ventral axis formation (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Glycine (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Notch signaling pathway (2)
- Pentose phosphate pathway (2)
- Phosphatidylinositol signaling system (2)
- Prion diseases (2)
- Propanoate metabolism (2)
- RIG-I-like receptor signaling pathway (2)
- Regulation of autophagy (2)
- Small cell lung cancer (2)
- Systemic lupus erythematosus (2)
- Type II diabetes mellitus (2)
- Vibrio cholerae infection (2)
- Viral myocarditis (2)
- serine and threonine metabolism (2)
- ABC transporters (1)
- Adipocytokine signaling pathway (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Arginine and proline metabolism (1)
- Basal transcription factors (1)
- Cysteine and methionine metabolism (1)
- DNA replication (1)
- Fatty acid metabolism (1)
- Glutathione metabolism (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Inositol phosphate metabolism (1)
- Lysine degradation (1)
- Lysosome (1)
- Mismatch repair (1)
- NOD-like receptor signaling pathway (1)
- Nucleotide excision repair (1)
- O-Glycan biosynthesis (1)
- Oxidative phosphorylation (1)
- PPAR signaling pathway (1)
- Proteasome (1)
- Pyrimidine metabolism (1)
- Pyruvate metabolism (1)
- Retinol metabolism (1)
- Ribosome (1)
- SNARE interactions in vesicular transport (1)
- Spliceosome (1)
- Terpenoid backbone biosynthesis (1)
- Type I diabetes mellitus (1)
- Valine (1)
- leucine and isoleucine degradation (1)
- p53 signaling pathway (1)